Gene Information

Name : LJP_1234c (LJP_1234c)
Accession : YP_005862506.1
Strain : Lactobacillus johnsonii DPC 6026
Genome accession: NC_017477
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1329783 - 1330493 bp
Length : 711 bp
Strand : -
Note : -

DNA sequence :
ATGCTAAAGATATTAATGGTTGAAGATGACAATTCTGTTGCGGAAATGATGAAAATGTTCTTTAGTAAAGAGCAGTGGGA
TGTAGATATAGCTAAAGATGGAGTAGAAGCTGTTGAAATGTTTAAGGCAGATCCAAGCTCTTATGATATCGTTACGCTAG
ATCTTAATTTACCTAAAAAAGATGGTATAGAAGTAGCAAAGGAGATTAGAGCTATTTCTATCTCAATACCGATCATTATG
TTAACGGCTAGAGATTCAGAAACTGATCAGATTTTAGGATTGGGAATTGGTGCAGACGAATATGTTACTAAGCCCTTTAG
TCCTTTGGCCTTAATAGCACGGATCAAGGCGCTATATCGCAGAAGCCATCTGGAAAAGGATATGCATGCTTCTAATGGCA
TAAAATATGATGTAGTAACTAAGCATTTAAAAATTTCGAAGGACCGTCGAGAAGTACGATTTGATGATAAAGTTGTTGAA
GGTTTGACCCCTAAGGAATTTGATTTGCTTTATACTATGGCTCAAAAGCCAAAGCAGGTTTTTTCAAGAGATAAACTTTT
AGAGCTAGTGTGGGGATATGAGTTTTTCGGTGAGGAAAGAACTGTCGATGCTCATATTAAAAAATTACGTCAAAAATTAG
AGAAAGCTGGTCCGCAAGTAGTTCAAACCGTTTGGGGTGTGGGCTACAAGTTTGATGATTCTGAGGTATAG

Protein sequence :
MLKILMVEDDNSVAEMMKMFFSKEQWDVDIAKDGVEAVEMFKADPSSYDIVTLDLNLPKKDGIEVAKEIRAISISIPIIM
LTARDSETDQILGLGIGADEYVTKPFSPLALIARIKALYRRSHLEKDMHASNGIKYDVVTKHLKISKDRREVRFDDKVVE
GLTPKEFDLLYTMAQKPKQVFSRDKLLELVWGYEFFGEERTVDAHIKKLRQKLEKAGPQVVQTVWGVGYKFDDSEV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-35 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-34 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LJP_1234c YP_005862506.1 two-component system response regulator NC_012469.1.7685629. Protein 2e-36 43
LJP_1234c YP_005862506.1 two-component system response regulator CP001918.1.gene5135. Protein 3e-22 42
LJP_1234c YP_005862506.1 two-component system response regulator NC_002952.2859905.p0 Protein 3e-38 41
LJP_1234c YP_005862506.1 two-component system response regulator NC_013450.8614421.p0 Protein 2e-38 41
LJP_1234c YP_005862506.1 two-component system response regulator NC_007793.3914279.p0 Protein 2e-38 41
LJP_1234c YP_005862506.1 two-component system response regulator NC_007622.3794472.p0 Protein 3e-38 41
LJP_1234c YP_005862506.1 two-component system response regulator NC_002745.1124361.p0 Protein 2e-38 41
LJP_1234c YP_005862506.1 two-component system response regulator NC_009782.5559369.p0 Protein 2e-38 41
LJP_1234c YP_005862506.1 two-component system response regulator NC_002951.3237708.p0 Protein 2e-38 41
LJP_1234c YP_005862506.1 two-component system response regulator NC_003923.1003749.p0 Protein 2e-38 41
LJP_1234c YP_005862506.1 two-component system response regulator NC_002758.1121668.p0 Protein 2e-38 41
LJP_1234c YP_005862506.1 two-component system response regulator NC_009641.5332272.p0 Protein 2e-38 41
LJP_1234c YP_005862506.1 two-component system response regulator HE999704.1.gene2815. Protein 2e-36 41
LJP_1234c YP_005862506.1 two-component system response regulator AE000516.2.gene3505. Protein 9e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LJP_1234c YP_005862506.1 two-component system response regulator VFG1563 Protein 5e-35 43
LJP_1234c YP_005862506.1 two-component system response regulator VFG1702 Protein 4e-35 43