Gene Information

Name : Cp267_1516 (Cp267_1516)
Accession : YP_005844333.1
Strain : Corynebacterium pseudotuberculosis 267
Genome accession: NC_017462
Putative virulence/resistance : Resistance
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1597869 - 1598081 bp
Length : 213 bp
Strand : +
Note : -

DNA sequence :
GTGACCATCACGTTCAAACCTCTGTGGAAACTCCTTATCGACCGAGAAATGACCAAAGAAGACCTACGCATCGCAACCGG
CTTATCAGCTGCGACCATCGCCAAGATGGGTAAAGACGGCAACGTCACCACAGAGGTTCTTGCCCGAATATGTACGGCAT
TAACGGCAGACATCAATGACATCTGCGAAGCCACCAAGGAGCCAAAGAAATGA

Protein sequence :
MTITFKPLWKLLIDREMTKEDLRIATGLSAATIAKMGKDGNVTTEVLARICTALTADINDICEATKEPKK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
CpC231_1455 YP_005683818.1 hypothetical protein Not tested PiCp 5 Protein 3e-26 100
CpI19_1462 YP_005685904.1 hypothetical protein Not tested PiCp 5 Protein 3e-26 100
cpfrc_01461 YP_003783861.1 hypothetical protein Not tested PiCp 5 Protein 5e-26 99
Cp1002_1456 YP_005681720.1 hypothetical protein Not tested PiCp 5 Protein 2e-25 98
SPN23F_09520 YP_002510935.1 regulatory protein Not tested PPI-1 Protein 1e-07 41
SP_1030 NP_345505.1 hypothetical protein Not tested PPI-1 Protein 1e-07 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cp267_1516 YP_005844333.1 hypothetical protein DQ212986.1.gene3.p01 Protein 6e-12 50