Gene Information

Name : Hprae_1776 (Hprae_1776)
Accession : YP_005837061.1
Strain : Halanaerobium praevalens DSM 2228
Genome accession: NC_017455
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1947204 - 1947893 bp
Length : 690 bp
Strand : -
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: hor:Hore_21640 two component transcriptional regulator, winged helix family; PFAM: response regulator re

DNA sequence :
ATGGCAAAAATTCTTGTAGTTGAAGATGAAAAAAATATTAGAGAGTTAATTAAATTTAATTTAGAAAATGCAGGTTATGA
AGTTTTGACAGCTGAAAATGGTAAAATAGCTCTTAATAGCTTAGAAGCTGAAATTGATTTAGTAGTTTTAGACTTGATGT
TACCAGAAGTTGATGGGATGGAAGTTTGTCGGCAGATGAGAGCAAATAAGAAGCTGAGGCAGATTCCAATCATAATGTTA
ACTGCCAAAGGAGAAGAAATAGAAAGAATTTTAGGGCTTGAAATGGGAGCAGATGATTATATGACTAAACCATTTAGCCC
TAGAGAATTGGTTGCGCGAATTAAAGCTATTTTTCGTCGGATTAAAGAATTGAAAGTAGATCAAGAAAAAATTAAAGATA
AGATAATCTCGGCTGGGAAATTAAAACTTGATATTCCCAGACATGAAGTTTTTTTGGGAACTGAAAAAATAATTTTAACT
CCTAAAGAATTTGAATTACTTCGGTATTTAGTTATTAATCAGGGTCGAGTTTTAAGTCGAGATTTGCTTTTAGAAAAAAT
ATGGGGTTATGAATATGCAGGTGATACAAGAACAGTCGATGTTCATATTAGAAGACTGCGTCAAAAAATAAAGGCTGATC
AGATAGTTACAGTGAGAGGGGTGGGATATAAATTTGCTAAAATGGAATAA

Protein sequence :
MAKILVVEDEKNIRELIKFNLENAGYEVLTAENGKIALNSLEAEIDLVVLDLMLPEVDGMEVCRQMRANKKLRQIPIIML
TAKGEEIERILGLEMGADDYMTKPFSPRELVARIKAIFRRIKELKVDQEKIKDKIISAGKLKLDIPRHEVFLGTEKIILT
PKEFELLRYLVINQGRVLSRDLLLEKIWGYEYAGDTRTVDVHIRRLRQKIKADQIVTVRGVGYKFAKME

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-40 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 7e-41 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-53 54
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-53 54
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-53 54
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-53 54
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-53 54
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-53 54
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-53 54
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-53 54
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-53 54
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-53 53
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-52 51
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 8e-49 49
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 9e-54 49
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 4e-48 48
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 3e-43 43
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 3e-43 43
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 2e-40 43
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 6e-39 43
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 4e-40 43
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator AF130997.1.orf0.gene Protein 4e-36 42
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 1e-33 42
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 4e-38 42
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator EU250284.1.orf4.gene Protein 4e-35 42
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 2e-34 42
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 1e-37 42
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator AF162694.1.orf4.gene Protein 3e-36 42
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 1e-33 41
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 9e-30 41
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 5e-38 41
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator BAC0596 Protein 2e-33 41
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 2e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator VFG1563 Protein 8e-41 43
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator VFG1702 Protein 3e-41 43
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-36 41
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator VFG1386 Protein 8e-36 41
Hprae_1776 YP_005837061.1 winged helix family two component transcriptional regulator VFG1389 Protein 5e-29 41