Gene Information

Name : Hprae_1011 (Hprae_1011)
Accession : YP_005836324.1
Strain : Halanaerobium praevalens DSM 2228
Genome accession: NC_017455
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1118352 - 1119029 bp
Length : 678 bp
Strand : +
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: hor:Hore_13280 two component transcriptional regulator, winged helix family; PFAM: response regulator re

DNA sequence :
ATGGAAAAAATATTAATTGTTGAAGATGAAGCTAAAATAAGGAAATTAATTAAAAGCTATTTAGCAGAAGAATATAAATT
AAAAGAAGCTGCAAATGGAAAAAAAGCATTATCTCTATTTAAAAATAATAATTTTGATTTAATTATTTTAGATTTAATGT
TACCTAAAATAAGTGGAGAAGAAGTTTGTCAAAATATAAGACAAATCTCTGATATTCCAATTATTATGTTAACTGCTAAA
AGTAGTGAAGAACATAAAATAGCTGGTTTTAATTATGGTGCAGATGATTATTTAACAAAGCCTTTTAGTCCTCGAGAATT
ATTAGTGCGTGTCAAAGCACTTTTAAGACGCAGTCAAAATGTTAAAAAAGCCAATGTCATCGCCTTAAATAAAGGAGAAT
ATAAGATATTCCCTGAAAAAATGATTGTCACAAAAGATGATCTTGATTGTGAACTCACAACTACAGAATTCAAAATTTTA
ATGGCCTTAATTAATAATGCAAATCAAGTTTTAAGTCGGGAACAATTAGCAGATATTGTGATGGGACTGGAGTTTAGTGG
ATTTGATAGAACTATAGATGCTCATATTAAAAATATAAGAAAAAAAATGAAATTAGAAAAAGATCAATATATAATTACAG
TCTATGGAGCTGGGTATAAGTTTATAGGTGATCTTTAA

Protein sequence :
MEKILIVEDEAKIRKLIKSYLAEEYKLKEAANGKKALSLFKNNNFDLIILDLMLPKISGEEVCQNIRQISDIPIIMLTAK
SSEEHKIAGFNYGADDYLTKPFSPRELLVRVKALLRRSQNVKKANVIALNKGEYKIFPEKMIVTKDDLDCELTTTEFKIL
MALINNANQVLSREQLADIVMGLEFSGFDRTIDAHIKNIRKKMKLEKDQYIITVYGAGYKFIGDL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_001698483.1 regulatory protein Not tested Not named Protein 8e-27 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Hprae_1011 YP_005836324.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 8e-33 44
Hprae_1011 YP_005836324.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 8e-33 44
Hprae_1011 YP_005836324.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-34 43
Hprae_1011 YP_005836324.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-32 43
Hprae_1011 YP_005836324.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-32 43
Hprae_1011 YP_005836324.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-32 43
Hprae_1011 YP_005836324.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-32 43
Hprae_1011 YP_005836324.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-32 43
Hprae_1011 YP_005836324.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-32 43
Hprae_1011 YP_005836324.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-32 43
Hprae_1011 YP_005836324.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-32 43
Hprae_1011 YP_005836324.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 6e-28 42
Hprae_1011 YP_005836324.1 winged helix family two component transcriptional regulator HE999704.1.gene1202. Protein 5e-30 42
Hprae_1011 YP_005836324.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 2e-31 42
Hprae_1011 YP_005836324.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 2e-31 42
Hprae_1011 YP_005836324.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 8e-34 42
Hprae_1011 YP_005836324.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 1e-31 42
Hprae_1011 YP_005836324.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-31 41
Hprae_1011 YP_005836324.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-31 41
Hprae_1011 YP_005836324.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-31 41
Hprae_1011 YP_005836324.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-31 41
Hprae_1011 YP_005836324.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-31 41
Hprae_1011 YP_005836324.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-31 41
Hprae_1011 YP_005836324.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-31 41
Hprae_1011 YP_005836324.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-31 41
Hprae_1011 YP_005836324.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 2e-28 41
Hprae_1011 YP_005836324.1 winged helix family two component transcriptional regulator CP004022.1.gene1676. Protein 2e-38 41