Gene Information

Name : czcR (KN400_2890)
Accession : YP_006891859.1
Strain : Geobacter sulfurreducens KN400
Genome accession: NC_017454
Putative virulence/resistance : Virulence
Product : winged-helix heavy metal transcriptional response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3138009 - 3138680 bp
Length : 672 bp
Strand : +
Note : 'domains: REC, trans_reg_C'

DNA sequence :
ATGCGCGTCCTGATCATCGAAGACGAAAAGAAGGCCGCCGCCTACCTCCAAAAGGGGTTCGCGGAGAACGGCTTCACGGC
CGACACCGCCGCATCCGGCGACGACGGCCTCCACTTGGCGCGTACCGAGAACTATGACCTGATCATCCTCGACATCATGC
TGCCCGGCCGGGACGGATGGGAAGTACTGGAAGAGCTGCGGAAAGAAGGGAGCGAGGTGCCGGTCATCTACCTGTCGGCC
CGGGATGCGGTGCACGACCGGGTGCGAGGGCTTGAACTGGGGGCCGACGACTACCTGGTGAAGCCCTTCGCCTTCTCGGA
ACTCCTGGCGCGGGCACGGACCATTCTCCGGCGAGGGCCGTCCCGCCAGCCGGAACGTCTGCGGGCTGACGACCTGGAGA
TGGATCTCGTGGGGCACAAGGCCCGGCGGGAGGGAAGGCCCATCGACCTCACCGCCAAGGAATTCATCCTGTTATCGCTG
CTTTTGCGCCGTAAAGGCGAGGTACTTTCCCGCACCCTCATCGCCGAACAGGTGTGGGGAATCAATTTCGACAGCGACAC
TAACATCGTCGACGTAGCGATCCGTCGGCTACGGCGCAAGGTCGACGACCCCTTCGAGAGGAAGCTCATCCACACCGTCC
GCGGAGCAGGCTATGTACTTGAAGCGAAGTGA

Protein sequence :
MRVLIIEDEKKAAAYLQKGFAENGFTADTAASGDDGLHLARTENYDLIILDIMLPGRDGWEVLEELRKEGSEVPVIYLSA
RDAVHDRVRGLELGADDYLVKPFAFSELLARARTILRRGPSRQPERLRADDLEMDLVGHKARREGRPIDLTAKEFILLSL
LLRRKGEVLSRTLIAEQVWGINFDSDTNIVDVAIRRLRRKVDDPFERKLIHTVRGAGYVLEAK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-60 60
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-59 58

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czcR YP_006891859.1 winged-helix heavy metal transcriptional response regulator BAC0125 Protein 5e-70 64
czcR YP_006891859.1 winged-helix heavy metal transcriptional response regulator BAC0197 Protein 5e-68 64
czcR YP_006891859.1 winged-helix heavy metal transcriptional response regulator BAC0083 Protein 5e-66 62
czcR YP_006891859.1 winged-helix heavy metal transcriptional response regulator BAC0638 Protein 3e-59 61
czcR YP_006891859.1 winged-helix heavy metal transcriptional response regulator BAC0308 Protein 2e-63 58
czcR YP_006891859.1 winged-helix heavy metal transcriptional response regulator BAC0111 Protein 2e-63 58
czcR YP_006891859.1 winged-helix heavy metal transcriptional response regulator BAC0347 Protein 7e-58 54
czcR YP_006891859.1 winged-helix heavy metal transcriptional response regulator NC_003923.1003417.p0 Protein 3e-39 44
czcR YP_006891859.1 winged-helix heavy metal transcriptional response regulator NC_013450.8614146.p0 Protein 3e-39 44
czcR YP_006891859.1 winged-helix heavy metal transcriptional response regulator NC_002951.3238224.p0 Protein 3e-39 44
czcR YP_006891859.1 winged-helix heavy metal transcriptional response regulator NC_007793.3914065.p0 Protein 3e-39 44
czcR YP_006891859.1 winged-helix heavy metal transcriptional response regulator NC_002758.1121390.p0 Protein 3e-39 44
czcR YP_006891859.1 winged-helix heavy metal transcriptional response regulator NC_010079.5776364.p0 Protein 3e-39 44
czcR YP_006891859.1 winged-helix heavy metal transcriptional response regulator NC_002952.2859858.p0 Protein 3e-39 44
czcR YP_006891859.1 winged-helix heavy metal transcriptional response regulator NC_007622.3794948.p0 Protein 3e-39 44
czcR YP_006891859.1 winged-helix heavy metal transcriptional response regulator HE999704.1.gene1528. Protein 9e-30 41
czcR YP_006891859.1 winged-helix heavy metal transcriptional response regulator AE000516.2.gene3505. Protein 3e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czcR YP_006891859.1 winged-helix heavy metal transcriptional response regulator VFG0596 Protein 1e-60 60
czcR YP_006891859.1 winged-helix heavy metal transcriptional response regulator VFG1389 Protein 3e-39 47
czcR YP_006891859.1 winged-helix heavy metal transcriptional response regulator VFG1390 Protein 3e-40 42
czcR YP_006891859.1 winged-helix heavy metal transcriptional response regulator VFG1386 Protein 2e-40 42