Gene Information

Name : MS7_2725 (MS7_2725)
Accession : YP_005756453.1
Strain :
Genome accession: NC_017350
Putative virulence/resistance : Resistance
Product : methicillin resistance regulatory protein mecI
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 6070 - 6450 bp
Length : 381 bp
Strand : +
Note : -

DNA sequence :

ATGGCCAATAAGCAAGTTGAAATATCTATGGCTGAATGGGATGTTATGAATATAATATGGGATAAAAAATCAGTATCAGC
TAATGAAATTGTAGTTGAAATTCAAAAATATAAAGAAGTTAGCGATAAAACGATTAGAACATTAATCACAAGACTATATA
AAAAAGAGATTATAAAACGATACAAATCAGAGAATATTTATTTTTACTCATCAAATATTAAAGAAGACGATATTAAAATG
AAAACTGCTAAAACCTTTCTTAATAAACTGTATGGAGGGGACATGAAAAGTTTAGTGCTGAATTTTGCGAAAAATGAAGA
ATTAAATAACAAAGAAATTGAAGAATTGCGAGACATTTTAAATGATATTAGTAAAAAGTAA

Protein sequence :

MANKQVEISMAEWDVMNIIWDKKSVSANEIVVEIQKYKEVSDKTIRTLITRLYKKEIIKRYKSENIYFYSSNIKEDDIKM
KTAKTFLNKLYGGDMKSLVLNFAKNEELNNKEIEELRDILNDISKK

• Homologs from PAI DB

Gene	GenBank Accn	Product	Virulance or Resistance	PAI or REI	Alignment Type	E-val	Identity
blaI	YP_253677.1	beta-lactamase repressor	Not tested	¥ÕSh1	Protein	1e-43	99
mecI	BAA82218.1	methicillin resistance protein MecI	Not tested	Type-II SCCmec	Protein	2e-20	62
mecI	NP_373280.1	methicillin resistance regulatory protein	Not tested	Type-II SCCmec	Protein	3e-20	62
mecI	YP_190060.1	methicillin-resistance regulatory protein MecI	Not tested	Type-II SCCmec	Protein	3e-20	62
mecI	YP_039517.1	methicillin resistance regulatory protein MecI	Not tested	Type-II SCCmec	Protein	5e-20	62
mecI	NP_370567.1	methicillin resistance regulatory protein	Not tested	Type-II SCCmec	Protein	1e-19	61
mecI	YP_005754043.1	methicillin resistance regulatory protein MecI	Not tested	Type-XI SCCmec	Protein	3e-20	52

• Homologs from CARD and BacMet (resistance genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
MS7_2725	YP_005756453.1	methicillin resistance regulatory protein mecI	NC_005011.2598314.p0	Protein	2e-44	100
MS7_2725	YP_005756453.1	methicillin resistance regulatory protein mecI	NC_005951.2853407.p0	Protein	2e-44	100
MS7_2725	YP_005756453.1	methicillin resistance regulatory protein mecI	NC_010066.5774788.p0	Protein	2e-44	100
MS7_2725	YP_005756453.1	methicillin resistance regulatory protein mecI	NC_002952.2858973.p0	Protein	4e-44	99
MS7_2725	YP_005756453.1	methicillin resistance regulatory protein mecI	NC_010419.6155809.p0	Protein	2e-44	99
MS7_2725	YP_005756453.1	methicillin resistance regulatory protein mecI	NC_005054.2598289.p0	Protein	4e-44	99
MS7_2725	YP_005756453.1	methicillin resistance regulatory protein mecI	NC_003140.1122763.p0	Protein	2e-44	99
MS7_2725	YP_005756453.1	methicillin resistance regulatory protein mecI	NC_002745.1122814.p0	Protein	8e-21	62
MS7_2725	YP_005756453.1	methicillin resistance regulatory protein mecI	NC_002952.2861158.p0	Protein	2e-20	62
MS7_2725	YP_005756453.1	methicillin resistance regulatory protein mecI	NC_009782.5560220.p0	Protein	4e-20	61
MS7_2725	YP_005756453.1	methicillin resistance regulatory protein mecI	NC_002758.1120003.p0	Protein	4e-20	61
MS7_2725	YP_005756453.1	methicillin resistance regulatory protein mecI	FR823292.1.gene6.p01	Protein	1e-20	52