Name : arsR (SARLGA251_00530) Accession : YP_005754066.1 Strain : Staphylococcus aureus LGA251 Genome accession: NC_017349 Putative virulence/resistance : Resistance Product : arsenical resistance operon repressor Function : - COG functional category : - COG ID : - EC number : - Position : 63387 - 63701 bp Length : 315 bp Strand : - Note : Similar to Staphylococcus xylosus arsr recname: full=arsenical resistance operon repressor UniProt:Q01256 (EMBL:M80565) (104 aa) fasta scores: E()=3.8e-34, 78.8% id in 104 aa DNA sequence : GTGTCTTATCAAGAACTAGCAACAATATTAAAAGTTTTATCTGATCCAAGCAGATTAGAAATAATAGATTTACTTTCATG TGGTGAACTATGTGCTTGTGATTTACTGGAACATTTTCAATTTTCACAGCCTACGCTAAGTCATCATATGAAGTCATTAG TCGATAAGCAATTAGTTCTTTCACGAAAAGAAGGTAATAAACATATGTATCGACTTAATCATGAAATTTTAGATGATGTT AATCACAACTTAAATCTTATTAATACATCTAACGTACGATGTGTATGTAAAAGTATGAAACAAGGTGAGTGTTAA Protein sequence : MSYQELATILKVLSDPSRLEIIDLLSCGELCACDLLEHFQFSQPTLSHHMKSLVDKQLVLSRKEGNKHMYRLNHEILDDV NHNLNLINTSNVRCVCKSMKQGEC |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
arsR | YP_005754066.1 | arsenical resistance operon repressor | Not tested | Type-XI SCCmec | Protein | 1e-43 | 100 |
arsR | YP_252018.1 | arsenical resistance operon repressor | Not tested | SCCmec | Protein | 2e-32 | 68 |
arsR | YP_252025.1 | arsenical resistance operon repressor | Not tested | SCCmec | Protein | 6e-32 | 63 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
arsR | YP_005754066.1 | arsenical resistance operon repressor | BAC0592 | Protein | 6e-37 | 80 |
arsR | YP_005754066.1 | arsenical resistance operon repressor | BAC0590 | Protein | 3e-37 | 79 |