Name : SARLGA251_00340 (SARLGA251_00340) Accession : YP_005754049.1 Strain : Staphylococcus aureus LGA251 Genome accession: NC_017349 Putative virulence/resistance : Unknown Product : hypothetical protein Function : - COG functional category : - COG ID : - EC number : - Position : 43009 - 43320 bp Length : 312 bp Strand : - Note : Similar to Staphylococcus aureus (strain MRSA252) subname: full=putative uncharacterized protein UniProt:Q6GKP4 (EMBL:BX571856) (103 aa) fasta scores: E()=2.3e-13, 47.2% id in 106 aa DNA sequence : ATGAATAAATATATAACACGGGGGATTGCCAATAACTTACCTACCACCTTACAGCATCAATTATGGCAACTTGTAGCACA ACGTGAAAACGAACAGTCCAAAAAAATAGAAGCAATAGATTACTTTCATATCTTCCAGTTCAATATGCATAATGATCAAT TATATATCAAACACAAACAAGAACGTCCTAAGTACATTAAAACTCATAAAGCTAATTATTCAAAAGCTATCAATATAAAT AAGGTCTACATTATCCGAGAAGATGATGAAGACCTTTCTTATTACGTCATGTTACTACCCGAAGAATATTAA Protein sequence : MNKYITRGIANNLPTTLQHQLWQLVAQRENEQSKKIEAIDYFHIFQFNMHNDQLYIKHKQERPKYIKTHKANYSKAININ KVYIIREDDEDLSYYVMLLPEEY |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
SARLGA251_00340 | YP_005754049.1 | hypothetical protein | Not tested | Type-XI SCCmec | Protein | 3e-43 | 100 |
unnamed | BAB47670.1 | hypothetical protein | Not tested | Type-III SCCmec | Protein | 4e-39 | 90 |
unnamed | BAC53832.1 | hypothetical protein | Not tested | SRImec-III and SCCmec-III region | Protein | 4e-39 | 90 |
SSP0048 | YP_300138.1 | hypothetical protein | Not tested | SCC15305cap | Protein | 1e-38 | 89 |
unnamed | AAL26664.1 | unknown | Not tested | SCCcap1 | Protein | 5e-32 | 86 |
unnamed | BAB47601.1 | hypothetical protein | Not tested | Type-III SCCmec | Protein | 3e-37 | 84 |
unnamed | ACL99834.1 | hypothetical protein | Not tested | Type-V SCCmec | Protein | 1e-37 | 82 |
unnamed | BAG06193.1 | hypothetical protein | Not tested | Type-VII SCCmec | Protein | 1e-37 | 82 |
SAPIG0036 | YP_005732846.1 | hypothetical protein | Not tested | Type-V SCCmec | Protein | 2e-37 | 82 |
SSP0032 | YP_300122.1 | hypothetical protein | Not tested | SCC15305RM | Protein | 2e-35 | 76 |
unnamed | BAB46980.2 | hypothetical protein | Not tested | Type-IIIinv SCCmec | Protein | 1e-17 | 50 |
unnamed | BAB83490.1 | - | Not tested | SCC 12263 | Protein | 1e-15 | 49 |
SACOL0038 | YP_184949.1 | hypothetical protein | Not tested | Type-I SCCmec | Protein | 5e-16 | 49 |
unnamed | BAA94330.1 | hypothetical protein | Not tested | Type-I SCCmec | Protein | 3e-16 | 49 |
unnamed | BAD24837.1 | hypothetical protein | Not tested | Type-V SCCmec | Protein | 1e-15 | 49 |
unnamed | BAA94662.1 | - | Not tested | Type-II SCCmec | Protein | 5e-15 | 48 |
SAMSHR1132_00370 | YP_005324561.1 | hypothetical protein | Not tested | Type-IIIinv SCCmec | Protein | 1e-15 | 48 |
SAR0057 | YP_039528.1 | hypothetical protein | Not tested | Type-II SCCmec | Protein | 7e-15 | 48 |
MW0036 | NP_644851.1 | hypothetical protein | Not tested | Type-IV SCCmec | Protein | 1e-15 | 48 |
SAV0059 | NP_370583.1 | hypothetical protein | Not tested | Type-II SCCmec | Protein | 7e-15 | 48 |
SAPIG0052 | YP_005732862.1 | hypothetical protein | Not tested | Type-V SCCmec | Protein | 9e-16 | 48 |
SA0055 | NP_373295.1 | hypothetical protein | Not tested | Type-II SCCmec | Protein | 7e-15 | 48 |
SERP2503 | YP_190045.1 | hypothetical protein | Not tested | Type-II SCCmec | Protein | 7e-15 | 48 |
unnamed | BAB72111.1 | hypothetical protein | Not tested | Type-IVa SCCmec | Protein | 9e-16 | 48 |
SH0058 | YP_251973.1 | hypothetical protein | Not tested | SCCmec | Protein | 3e-15 | 48 |
unnamed | BAB72130.1 | hypothetical protein | Not tested | Type-IVb SCCmec | Protein | 9e-16 | 48 |
SE0053 | NP_763608.1 | hypothetical protein | Not tested | SCCpbp4 | Protein | 2e-15 | 48 |
unnamed | BAC67563.1 | hypothetical protein | Not tested | Type-IVc SCCmec | Protein | 9e-16 | 48 |
SAS0030 | YP_042163.1 | hypothetical protein | Not tested | SCC476 | Protein | 2e-15 | 48 |
SE0031 | NP_763586.1 | hypothetical protein | Not tested | SCCpbp4 | Protein | 1e-15 | 48 |
unnamed | BAG06214.1 | hypothetical protein | Not tested | Type-VII SCCmec | Protein | 1e-15 | 48 |
unnamed | ACL99846.1 | hypothetical protein | Not tested | Type-V SCCmec | Protein | 3e-16 | 48 |