Gene Information

Name : mecI (SARLGA251_00280)
Accession : YP_005754043.1
Strain : Staphylococcus aureus LGA251
Genome accession: NC_017349
Putative virulence/resistance : Resistance
Product : methicillin resistance regulatory protein MecI
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 39530 - 39904 bp
Length : 375 bp
Strand : +
Note : Similar to Staphylococcus aureus (strain N315) meci recname: full=methicillin resistance regulatory protein meci UniProt:P68261 (EMBL:BA000018) (123 aa) fasta scores: E()=8.8e-30, 66.7% id in 123 aa

DNA sequence :
ATGACACGTGAAGGCTATGATATATCAGCGTCAGAATGGGAAATAATGAATACGATTTGGAATAAAAAATTAATAAGTGC
TAATGACGTTATAGAAATAGTACAAAAGCACAAGGAATGGAGTCCAAAAACAATAAGAACACTAATCAATCGTCTTTACA
AAAAGAAATTCATAGATAGAACAAGTCGAAATAAAATTTTTGAATATTTCCCAATAGTAGAGGAAAAAGATATGAAGTAC
AAAACGTCTAAAGTGTTTTTGGATAAAGTGTATGAAGGTGGATTAAATTCATTAGTCTTAAATTTTGTTGAAAATGAAGA
ATTGTCCGAAGATGATATTGAAGAATTGAAAAATATATTAAATAATAAATATTAA

Protein sequence :
MTREGYDISASEWEIMNTIWNKKLISANDVIEIVQKHKEWSPKTIRTLINRLYKKKFIDRTSRNKIFEYFPIVEEKDMKY
KTSKVFLDKVYEGGLNSLVLNFVENEELSEDDIEELKNILNNKY

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
mecI YP_005754043.1 methicillin resistance regulatory protein MecI Not tested Type-XI SCCmec Protein 9e-45 100
mecI BAA82218.1 methicillin resistance protein MecI Not tested Type-II SCCmec Protein 4e-31 67
mecI NP_370567.1 methicillin resistance regulatory protein Not tested Type-II SCCmec Protein 1e-30 67
mecI NP_373280.1 methicillin resistance regulatory protein Not tested Type-II SCCmec Protein 6e-31 67
mecI YP_190060.1 methicillin-resistance regulatory protein MecI Not tested Type-II SCCmec Protein 6e-31 67
mecI YP_039517.1 methicillin resistance regulatory protein MecI Not tested Type-II SCCmec Protein 2e-30 67
blaI YP_253677.1 beta-lactamase repressor Not tested ¥ÕSh1 Protein 2e-20 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mecI YP_005754043.1 methicillin resistance regulatory protein MecI FR823292.1.gene6.p01 Protein 3e-45 100
mecI YP_005754043.1 methicillin resistance regulatory protein MecI NC_009782.5560220.p0 Protein 5e-31 67
mecI YP_005754043.1 methicillin resistance regulatory protein MecI NC_002758.1120003.p0 Protein 5e-31 67
mecI YP_005754043.1 methicillin resistance regulatory protein MecI NC_002745.1122814.p0 Protein 2e-31 67
mecI YP_005754043.1 methicillin resistance regulatory protein MecI NC_002952.2861158.p0 Protein 7e-31 67
mecI YP_005754043.1 methicillin resistance regulatory protein MecI NC_003140.1122763.p0 Protein 3e-21 53
mecI YP_005754043.1 methicillin resistance regulatory protein MecI NC_010419.6155809.p0 Protein 3e-21 53
mecI YP_005754043.1 methicillin resistance regulatory protein MecI NC_005054.2598289.p0 Protein 6e-21 52
mecI YP_005754043.1 methicillin resistance regulatory protein MecI NC_005011.2598314.p0 Protein 5e-21 52
mecI YP_005754043.1 methicillin resistance regulatory protein MecI NC_005951.2853407.p0 Protein 5e-21 52
mecI YP_005754043.1 methicillin resistance regulatory protein MecI NC_002952.2858973.p0 Protein 6e-21 52
mecI YP_005754043.1 methicillin resistance regulatory protein MecI NC_010066.5774788.p0 Protein 5e-21 52
mecI YP_005754043.1 methicillin resistance regulatory protein MecI AM180355.1.gene595.p Protein 4e-13 46