Gene Information

Name : SAA6008_00443 (SAA6008_00443)
Accession : YP_005743819.1
Strain : Staphylococcus aureus JKD6008
Genome accession: NC_017341
Putative virulence/resistance : Virulence
Product : staphylococcal tandem lipoprotein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 479776 - 480507 bp
Length : 732 bp
Strand : +
Note : identified by match to protein family HMM PF04507; match to protein family HMM TIGR01742

DNA sequence :
TTGATTTTAAGCATTTTTGTAACATCTTGCGATGGTGATAATAAGATCACTGGAGATTCAAAAGAAACACAAATCAAAAA
GAGCTTTTCGAAAACGTTAGATATGTATCCAATTAAGAATCTCGAGGACTTATATGATAAAGAAGGATACCGTGATGGCG
AATTTAAAAAGGGCGACAAAGGAATGTGGACTATATATACAGATTTTGCTAAAGGCAATAAATCAGACGAATTGGATGAT
GAAGGTATGGTTTTAAATCTGGATAGAAATACTCGAACGGCTAAGGGATATTATTTTGTTAAGAAATTTTATGAAAAGGA
TAAATTACCTGATAGAAAAAATTATAAAGTTGAAATGAAAAATAATAAAATTATCTTATTAGACAAGGTAGAAGATCCAA
ATCTAAAAAAGAGAATAGAAAACTTTAAATTTTTCGGACAATATGCAAATTTTAAGGATTTGGAAAATTACAACAATGGC
GACGTGTCAATAAATTGGAATGTTCCAAGTTATGACGTGGAATATAAAATGAGCAATAAAGATGAAAATGTTAAACAATT
AAGAAGTCGTTATAACATTCCTACTGATAAAGCTCCAATGTTAAAAATGCATATTGACGGGGACTTAAAAGGTAGTTCTG
TTGGATATAAAAGGTTAGAAATAGATTTTTCAAAAGAAGGTAGGGATATTTCAGTCATTGATTATTTAAGTTATAAGCCA
GCGAAAAAATAG

Protein sequence :
MILSIFVTSCDGDNKITGDSKETQIKKSFSKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKGNKSDELDD
EGMVLNLDRNTRTAKGYYFVKKFYEKDKLPDRKNYKVEMKNNKIILLDKVEDPNLKKRIENFKFFGQYANFKDLENYNNG
DVSINWNVPSYDVEYKMSNKDENVKQLRSRYNIPTDKAPMLKMHIDGDLKGSSVGYKRLEIDFSKEGRDISVIDYLSYKP
AKK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
lpl4nm YP_001331441.1 tandem lipoprotein Not tested vSa¥á Protein 1e-106 99
SAUSA300_0414 YP_493127.1 tandem lipoprotein Not tested vSa¥á Protein 1e-107 99
SAS0400 YP_042526.1 hypothetical protein Not tested vSa¥á Protein 4e-104 96
lpl11 NP_645215.1 hypothetical protein Not tested vSa¥á Protein 4e-104 96
SAR0442 YP_039891.1 hypothetical protein Not tested vSa¥á Protein 6e-103 95
SACOL0481 YP_185371.1 hypothetical protein Not tested vSa¥á Protein 1e-101 94
SAMSHR1132_03930 YP_005324914.1 hypothetical protein Not tested vSa¥á Protein 2e-95 84
lpl14 NP_645218.1 hypothetical protein Not tested vSa¥á Protein 2e-86 84
SAKOR_00425 YP_008490609.1 Membrane lipoprotein Not tested vSa¥á Protein 8e-88 81
lpl7 NP_370967.1 hypothetical protein Not tested vSa¥á Protein 8e-88 81
lpl7 NP_373654.1 hypothetical protein Not tested vSa¥á Protein 8e-88 81
SAR0443 YP_039892.1 lipoprotein Not tested vSa¥á Protein 6e-88 81
SAR0439 YP_039890.1 lipoprotein Not tested vSa¥á Protein 1e-86 79
SAMSHR1132_03890 YP_005324910.1 putative lipoprotein Not tested vSa¥á Protein 2e-85 79
SAMSHR1132_03940 YP_005324915.1 putative lipoprotein Not tested vSa¥á Protein 1e-89 79
lpl9 NP_370969.1 hypothetical protein Not tested vSa¥á Protein 1e-86 79
lpl9 NP_373656.1 hypothetical protein Not tested vSa¥á Protein 1e-86 79
SAS0403 YP_042529.1 lipoprotein Not tested vSa¥á Protein 6e-88 79
lpl3nm YP_001331440.1 tandem lipoprotein Not tested vSa¥á Protein 1e-86 79
SAUSA300_0413 YP_493126.1 tandem lipoprotein Not tested vSa¥á Protein 1e-86 79
lpl1nm YP_001331437.1 tandem lipoprotein Not tested vSa¥á Protein 5e-86 79
SAMSHR1132_03860 YP_005324907.1 putative lipoprotein Not tested vSa¥á Protein 2e-87 79
lpl1 NP_370960.1 hypothetical protein Not tested vSa¥á Protein 2e-82 79
lpl1 NP_373647.1 hypothetical protein Virulence vSa¥á Protein 2e-82 79
SAKOR_00428 YP_008490612.1 Membrane lipoprotein Not tested vSa¥á Protein 2e-86 79
SACOL0484 YP_185374.1 hypothetical protein Not tested vSa¥á Protein 4e-86 78
lpl7nm YP_001331444.1 tandem lipoprotein Not tested vSa¥á Protein 4e-86 78
SAUSA300_0417 YP_493130.1 tandem lipoprotein Not tested vSa¥á Protein 4e-86 78
SAUSA300_0410 YP_493124.1 tandem lipoprotein Not tested vSa¥á Protein 2e-85 78
SAV0440 NP_370964.1 hypothetical protein Not tested vSa¥á Protein 8e-87 77
lpl4 NP_373651.1 hypothetical protein Not tested vSa¥á Protein 3e-87 77
SAKOR_00423 YP_008490607.1 Membrane lipoprotein Not tested vSa¥á Protein 3e-83 77
SAKOR_00420 YP_008490604.1 Membrane lipoprotein Not tested vSa¥á Protein 2e-84 77
SAUSA300_0411 YP_493125.1 tandem lipoprotein Not tested vSa¥á Protein 2e-84 76
lpl2nm YP_001331438.1 tandem lipoprotein Not tested vSa¥á Protein 2e-84 76
SAKOR_00424 YP_008490608.1 Membrane lipoprotein Not tested vSa¥á Protein 8e-73 70
SAMSHR1132_03900 YP_005324911.1 putative lipoprotein Not tested vSa¥á Protein 6e-74 69
SAKOR_00422 YP_008490606.1 Membrane lipoprotein Not tested vSa¥á Protein 6e-77 66
SAS0401 YP_042527.1 lipoprotein Not tested vSa¥á Protein 1e-69 64
lpl12 NP_645216.1 hypothetical protein Not tested vSa¥á Protein 1e-69 64
lpl6 NP_370966.1 hypothetical protein Not tested vSa¥á Protein 6e-70 64
lpl6 NP_373653.1 hypothetical protein Not tested vSa¥á Protein 6e-70 64
lpl2 NP_370961.1 hypothetical protein Not tested vSa¥á Protein 6e-72 63
lpl2 NP_373648.1 hypothetical protein Virulence vSa¥á Protein 6e-72 63
SAR0438 YP_039889.1 lipoprotein Not tested vSa¥á Protein 9e-73 63
SAMSHR1132_03840 YP_005324905.1 putative lipoprotein Not tested vSa¥á Protein 1e-70 62
lpl9nm YP_001331446.1 tandem lipoprotein Not tested vSa¥á Protein 1e-69 61
SACOL0486 YP_185376.1 hypothetical protein Not tested vSa¥á Protein 1e-69 61
SAMSHR1132_03870 YP_005324908.1 putative lipoprotein Not tested vSa¥á Protein 7e-68 60
SAUSA300_0419 YP_493132.1 tandem lipoprotein Not tested vSa¥á Protein 2e-69 60
SAS0399 YP_042525.1 lipoprotein Not tested vSa¥á Protein 2e-68 60
lpl10 NP_645214.1 hypothetical protein Not tested vSa¥á Protein 2e-68 60
SACOL0485 YP_185375.1 hypothetical protein Not tested vSa¥á Protein 6e-56 60
lpl8nm YP_001331445.1 tandem lipoprotein Not tested vSa¥á Protein 6e-56 60
SAUSA300_0418 YP_493131.1 tandem lipoprotein Not tested vSa¥á Protein 6e-56 60
SAR0444 YP_039893.1 lipoprotein Not tested vSa¥á Protein 3e-58 58
lpl8 NP_373655.1 hypothetical protein Not tested vSa¥á Protein 8e-52 56
lpl8 NP_370968.1 hypothetical protein Not tested vSa¥á Protein 8e-52 56
SAMSHR1132_03880 YP_005324909.1 putative lipoprotein Not tested vSa¥á Protein 1e-55 55
SAKOR_00421 YP_008490605.1 Membrane lipoprotein Not tested vSa¥á Protein 2e-55 54
SAS0402 YP_042528.1 lipoprotein Not tested vSa¥á Protein 3e-54 54
lpl13 NP_645217.1 hypothetical protein Not tested vSa¥á Protein 3e-54 54
unnamed AAL26686.1 unknown Not tested SCCcap1 Protein 3e-51 53
SACOL0483 YP_185373.1 staphyloccoccus tandem lipoprotein Not tested vSa¥á Protein 2e-54 53
lpl6nm YP_001331443.1 tandem lipoprotein Not tested vSa¥á Protein 2e-54 53
SAUSA300_0416 YP_493129.1 tandem lipoprotein Not tested vSa¥á Protein 2e-54 53
lpl3 NP_370962.1 hypothetical protein Not tested vSa¥á Protein 2e-52 53
lpl3 NP_373649.1 hypothetical protein Virulence vSa¥á Protein 2e-52 53
SAMSHR1132_03850 YP_005324906.1 putative lipoprotein Not tested vSa¥á Protein 8e-54 52
SAMSHR1132_03920 YP_005324913.1 putative lipoprotein Not tested vSa¥á Protein 2e-52 52
lpl5 NP_370965.1 hypothetical protein Not tested vSa¥á Protein 6e-48 51
lpl5 NP_373652.1 hypothetical protein Not tested vSa¥á Protein 6e-48 51
SACOL0482 YP_185372.1 hypothetical protein Not tested vSa¥á Protein 2e-48 49
lpl5nm YP_001331442.1 tandem lipoprotein Not tested vSa¥á Protein 2e-48 49
SAMSHR1132_03910 YP_005324912.1 putative lipoprotein Not tested vSa¥á Protein 3e-48 48
lpl3 YP_493128.1 tandem lipoprotein Not tested vSa¥á Protein 3e-48 48
SAR0445 YP_039894.1 lipoprotein Not tested vSa¥á Protein 4e-53 48