Gene Information

Name : SA2981_0041 (SA2981_0041)
Accession : YP_005740793.1
Strain : Staphylococcus aureus 04-02981
Genome accession: NC_017340
Putative virulence/resistance : Resistance
Product : Methicillin resistance repressor MecI
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 47897 - 48268 bp
Length : 372 bp
Strand : +
Note : -

DNA sequence :
ATGGATAATAAAACGTATGAAATATCATCTGCAGAATGGGAAGTTATGAATATCATTTGGATGAAAAAATATGCAAGTGC
GAATAATATAATAGAAGAAATACAAATGCAAAAGGACTGGAGTCCAAAAACCATTCGTACACTTATAACGAGATTGTATA
AAAAGGGATTTATAGATCGTAAAAAAGACAATAAAATTTTTCAATATTACTCTCTTGTAGAAGAAAGTGATATAAAATAT
AAAACATCTAAAAACTTTATCAATAAAGTATACAAAGGCGGTTTCAATTCACTTGTCTTAAACTTTGTAGAAAAAGAAGA
TCTATCACAAGATGAAATAGAAGAATTGAGAAATATATTGAATAAAAAATAA

Protein sequence :
MDNKTYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQYYSLVEESDIKY
KTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELRNILNKK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
mecI YP_039517.1 methicillin resistance regulatory protein MecI Not tested Type-II SCCmec Protein 3e-46 100
mecI NP_373280.1 methicillin resistance regulatory protein Not tested Type-II SCCmec Protein 4e-50 100
mecI YP_190060.1 methicillin-resistance regulatory protein MecI Not tested Type-II SCCmec Protein 4e-50 100
mecI BAA82218.1 methicillin resistance protein MecI Not tested Type-II SCCmec Protein 3e-50 100
mecI NP_370567.1 methicillin resistance regulatory protein Not tested Type-II SCCmec Protein 2e-49 99
mecI YP_005754043.1 methicillin resistance regulatory protein MecI Not tested Type-XI SCCmec Protein 3e-37 67
blaI YP_253677.1 beta-lactamase repressor Not tested ¥ÕSh1 Protein 1e-25 62

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SA2981_0041 YP_005740793.1 Methicillin resistance repressor MecI NC_002952.2861158.p0 Protein 9e-47 100
SA2981_0041 YP_005740793.1 Methicillin resistance repressor MecI NC_002745.1122814.p0 Protein 1e-50 100
SA2981_0041 YP_005740793.1 Methicillin resistance repressor MecI NC_009782.5560220.p0 Protein 6e-50 99
SA2981_0041 YP_005740793.1 Methicillin resistance repressor MecI NC_002758.1120003.p0 Protein 6e-50 99
SA2981_0041 YP_005740793.1 Methicillin resistance repressor MecI FR823292.1.gene6.p01 Protein 9e-38 67
SA2981_0041 YP_005740793.1 Methicillin resistance repressor MecI NC_010419.6155809.p0 Protein 4e-26 62
SA2981_0041 YP_005740793.1 Methicillin resistance repressor MecI NC_010066.5774788.p0 Protein 3e-26 62
SA2981_0041 YP_005740793.1 Methicillin resistance repressor MecI NC_005054.2598289.p0 Protein 3e-26 62
SA2981_0041 YP_005740793.1 Methicillin resistance repressor MecI NC_003140.1122763.p0 Protein 4e-26 62
SA2981_0041 YP_005740793.1 Methicillin resistance repressor MecI NC_005011.2598314.p0 Protein 3e-26 62
SA2981_0041 YP_005740793.1 Methicillin resistance repressor MecI NC_005951.2853407.p0 Protein 3e-26 62
SA2981_0041 YP_005740793.1 Methicillin resistance repressor MecI NC_002952.2858973.p0 Protein 3e-26 62
SA2981_0041 YP_005740793.1 Methicillin resistance repressor MecI AM180355.1.gene595.p Protein 1e-20 48