Gene Information

Name : SA2981_1901 (SA2981_1901)
Accession : YP_005742650.1
Strain : Staphylococcus aureus 04-02981
Genome accession: NC_017340
Putative virulence/resistance : Virulence
Product : Involved in expression of fibrinogen binding protein, phage associated
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2039558 - 2039908 bp
Length : 351 bp
Strand : -
Note : -

DNA sequence :
ATGAAAATTAGAAAATCTATACTTGCGGGAACTTTAGCAATCGTTTTAGCATCACCACTAGTAACTAATCTAGATAAAAA
TGAGGCACAAGCTAGCACAAGCTTGCCAACATCGAATGAATATCAAAACGAAAAGTTAGCTAATGAATTAAAATCGTTAT
TAGATGAACTAAATGTTAATGAATTAGCTACTGGAAGTTTAAACACTTATTATAAGCGAACTATAAAAATTTCAGGTCTA
AAAGCAATGTATGCTCTTAAGTCAAAAGACTTTAAGAAAATGTCAGAAGCAAAATATCAACTTCAAAAGATTTATAACGA
AATTGACGAAGCACTAAAAAGTAAATATTAA

Protein sequence :
MKIRKSILAGTLAIVLASPLVTNLDKNEAQASTSLPTSNEYQNEKLANELKSLLDELNVNELATGSLNTYYKRTIKISGL
KAMYALKSKDFKKMSEAKYQLQKIYNEIDEALKSKY

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SA1754 NP_375049.1 hypothetical protein Not tested ¥ÕSa3 Protein 1e-45 100
SAUSA300_1919 YP_494570.1 hypothetical protein Not tested ¥ÕSa3 Protein 7e-45 99
MW1884 NP_646701.1 hypothetical protein Not tested ¥ÕSa3 Protein 7e-45 99
SAV1942 NP_372466.1 hypothetical protein Not tested ¥ÕSa3 Protein 7e-45 99
SAUSA300_1919 YP_494570.1 hypothetical protein Not tested ¥ÕSa3 Protein 7e-45 99
SAKOR_01918 YP_008492106.1 Complement inhibitor SCIN Not tested ¥ÕSa3 Protein 5e-30 98
SAOV_2052c YP_005737495.1 staphylococcal complement inhibitor (scin) related protein Not tested SaPI2 Protein 5e-20 48
SAV1159 NP_371683.1 fibrinogen-binding protein Not tested vSa¥ã Protein 3e-18 46
SA1004 NP_374275.1 hypothetical protein Not tested vSa¥ã Protein 3e-18 46
SAUSA300_1056 YP_493754.1 hypothetical protein Not tested vSa¥ã Protein 3e-18 46
SAKOR_01080 YP_008491268.1 Hypothetical protein Not tested vSa¥ã Protein 3e-18 46
SACOL1169 YP_186032.1 fibrinogen-binding protein precursor-like protein Not tested vSa¥ã Protein 3e-18 46
MW1041 NP_645858.1 hypothetical protein Not tested vSa¥ã Protein 3e-18 46

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SA2981_1901 YP_005742650.1 Involved in expression of fibrinogen binding protein, phage associated VFG2423 Protein 2e-45 99