Gene Information

Name : ureA (SAA6159_02192)
Accession : YP_005740323.1
Strain : Staphylococcus aureus JKD6159
Genome accession: NC_017338
Putative virulence/resistance : Virulence
Product : urease gamma subunit UreA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2348804 - 2349106 bp
Length : 303 bp
Strand : +
Note : UreA, with UreB and UreC catalyzes the hydrolysis of urea into ammonia and carbon dioxide; nickel metalloenzyme; accessory proteins UreD, UreE, UreF, and UreG are necessary for assembly of the metallocenter

DNA sequence :
TTGCATTTTACACAACGAGAGCAAGACAAATTAATGATTGTAGTGGCGGCGGAAGTTGCACGTCGTCGTAAAGCACGTGG
TTTGAAACTAAATCACCCTGAGGCATTAGCTTTAATCAGCGATGAATTATTAGAAGGTGCACGCGATGGTAAGACCGTTG
CAGAGTTAATGAGTTATGGTAGACAAATTCTAAACAAAGAAGATGTCATGGATGGTGTCGAACACATGATTACAGATATC
GAAATCGAGGCTACGTTCCCCGATGGTACTAAGTTAATCACAGTACATCACCCTATTGTTTAA

Protein sequence :
MHFTQREQDKLMIVVAAEVARRRKARGLKLNHPEALALISDELLEGARDGKTVAELMSYGRQILNKEDVMDGVEHMITDI
EIEATFPDGTKLITVHHPIV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ureA YP_005682176.1 urease subunit gamma Not tested PiCp 7 Protein 1e-27 77
ureA YP_005684268.1 urease subunit gamma Not tested PiCp 7 Protein 1e-27 77
ureA YP_003784327.1 urease subunit gamma Not tested PiCp 7 Protein 1e-27 77
ureA YP_005686360.1 urease subunit gamma Not tested PiCp 7 Protein 1e-27 77
ureA NP_286678.1 urease subunit gamma Virulence TAI Protein 3e-21 61
ureA NP_287086.1 urease subunit gamma Not tested TAI Protein 3e-21 61