Name : ureA (SAA6159_02192) Accession : YP_005740323.1 Strain : Staphylococcus aureus JKD6159 Genome accession: NC_017338 Putative virulence/resistance : Virulence Product : urease gamma subunit UreA Function : - COG functional category : - COG ID : - EC number : - Position : 2348804 - 2349106 bp Length : 303 bp Strand : + Note : UreA, with UreB and UreC catalyzes the hydrolysis of urea into ammonia and carbon dioxide; nickel metalloenzyme; accessory proteins UreD, UreE, UreF, and UreG are necessary for assembly of the metallocenter DNA sequence : TTGCATTTTACACAACGAGAGCAAGACAAATTAATGATTGTAGTGGCGGCGGAAGTTGCACGTCGTCGTAAAGCACGTGG TTTGAAACTAAATCACCCTGAGGCATTAGCTTTAATCAGCGATGAATTATTAGAAGGTGCACGCGATGGTAAGACCGTTG CAGAGTTAATGAGTTATGGTAGACAAATTCTAAACAAAGAAGATGTCATGGATGGTGTCGAACACATGATTACAGATATC GAAATCGAGGCTACGTTCCCCGATGGTACTAAGTTAATCACAGTACATCACCCTATTGTTTAA Protein sequence : MHFTQREQDKLMIVVAAEVARRRKARGLKLNHPEALALISDELLEGARDGKTVAELMSYGRQILNKEDVMDGVEHMITDI EIEATFPDGTKLITVHHPIV |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
ureA | YP_005686360.1 | urease subunit gamma | Not tested | PiCp 7 | Protein | 1e-27 | 77 |
ureA | YP_005682176.1 | urease subunit gamma | Not tested | PiCp 7 | Protein | 1e-27 | 77 |
ureA | YP_005684268.1 | urease subunit gamma | Not tested | PiCp 7 | Protein | 1e-27 | 77 |
ureA | YP_003784327.1 | urease subunit gamma | Not tested | PiCp 7 | Protein | 1e-27 | 77 |
ureA | NP_286678.1 | urease subunit gamma | Virulence | TAI | Protein | 3e-21 | 61 |
ureA | NP_287086.1 | urease subunit gamma | Not tested | TAI | Protein | 3e-21 | 61 |