Gene Information

Name : soxS (SFxv_4498)
Accession : YP_005729712.1
Strain : Shigella flexneri 2002017
Genome accession: NC_017328
Putative virulence/resistance : Resistance
Product : Regulation of superoxide response regulon
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4328761 - 4329084 bp
Length : 324 bp
Strand : -
Note : -

DNA sequence :
ATGTCCCATCAGAAAATTATTCAGGATCTTATCGCATGGATTGACGTGCATATTGACCAGCCGCTTAACATTGATGTCGT
CGCAAAAAAATCAGGCTATTCAAAGTGGTACTTGCAACGGATGTTCCGCACGGTGACGCATCAGACGCTTGGCGATTACA
TTCGCCAACGCCGCCTGTTACTGGCCGCCGTTGAGTTGCGCACCACCGAGCGTCCGATTTTTGATATCGCAATGGACCTG
GGTTATGTCTCGCAGCAGACCTTCTCCCGCGTTTTCCGTCGGCAGTTTGATCGCACTCCCAGCGATTATCGCCACCGCCT
GTAG

Protein sequence :
MSHQKIIQDLIAWIDVHIDQPLNIDVVAKKSGYSKWYLQRMFRTVTHQTLGDYIRQRRLLLAAVELRTTERPIFDIAMDL
GYVSQQTFSRVFRRQFDRTPSDYRHRL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 9e-45 95
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 2e-21 51
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 2e-21 51

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
soxS YP_005729712.1 Regulation of superoxide response regulon CP000034.1.gene4505. Protein 3e-46 99
soxS YP_005729712.1 Regulation of superoxide response regulon BAC0371 Protein 2e-46 99
soxS YP_005729712.1 Regulation of superoxide response regulon NC_002695.1.914293.p Protein 2e-46 99
soxS YP_005729712.1 Regulation of superoxide response regulon CP001138.1.gene4488. Protein 3e-45 95
soxS YP_005729712.1 Regulation of superoxide response regulon CP001918.1.gene327.p Protein 2e-43 89
soxS YP_005729712.1 Regulation of superoxide response regulon CP000647.1.gene4499. Protein 8e-43 88
soxS YP_005729712.1 Regulation of superoxide response regulon NC_010558.1.6276025. Protein 9e-22 51
soxS YP_005729712.1 Regulation of superoxide response regulon CP001138.1.gene612.p Protein 2e-23 46
soxS YP_005729712.1 Regulation of superoxide response regulon CP000647.1.gene1624. Protein 3e-19 43
soxS YP_005729712.1 Regulation of superoxide response regulon CP001918.1.gene2033. Protein 3e-19 43
soxS YP_005729712.1 Regulation of superoxide response regulon CP001138.1.gene1637. Protein 5e-19 42
soxS YP_005729712.1 Regulation of superoxide response regulon BAC0560 Protein 5e-19 42
soxS YP_005729712.1 Regulation of superoxide response regulon NC_002695.1.917339.p Protein 5e-19 42
soxS YP_005729712.1 Regulation of superoxide response regulon CP000034.1.gene1596. Protein 4e-19 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
soxS YP_005729712.1 Regulation of superoxide response regulon VFG0585 Protein 3e-45 95
soxS YP_005729712.1 Regulation of superoxide response regulon VFG1038 Protein 8e-22 51