Gene Information

Name : SM11_pC1589 (SM11_pC1589)
Accession : YP_005725471.1
Strain :
Genome accession: NC_017327
Putative virulence/resistance : Resistance
Product : Transcriptional regulator, MerR/CueR family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1473138 - 1473542 bp
Length : 405 bp
Strand : -
Note : -

DNA sequence :
ATGGTACAGAGTCAAGGCCTTCAAGAACTGACGATCGGAAAACTTGCGGCGGCCGGAGGCGTGGGTGTTGAAACCATCCG
TTTCTACCAGCGCAAGGGCCTGCTGGCGACGCCGAAGCGGTTAGAAGGCGTGCGCCGCTATGGAGGCGAAGACGTGCGCC
GACTACGTTTCATAAAACAGGCGCAGGCGGCCGGTTTCACGCTTGAGGAGATCGGGCAGCTTCTGGCACTGGATGCCGGG
CACAACCGCTCGGCCGCACGGGAACTGGCGAAGAAGAAGCTTGAGCAGCTGGATGCCAGAATTGGAGAGCTTAATCGCGC
CCGGGAAGCACTCCGTAAGCTGGTCTCTGAATGCGCAGAGGACAAGACCGGGCCGTGTCCGATCCTGGCTTCCTTTGGAG
TTTGA

Protein sequence :
MVQSQGLQELTIGKLAAAGGVGVETIRFYQRKGLLATPKRLEGVRRYGGEDVRRLRFIKQAQAAGFTLEEIGQLLALDAG
HNRSAARELAKKKLEQLDARIGELNRAREALRKLVSECAEDKTGPCPILASFGV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 4e-25 50
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 2e-25 49
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 2e-26 48
merR ACK44535.1 MerR Not tested SGI1 Protein 2e-25 47
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 2e-25 47
merR AFG30124.1 MerR Not tested PAGI-2 Protein 2e-25 47
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 3e-25 47
merR AGK07025.1 MerR Not tested SGI1 Protein 5e-25 47
merR AGK07083.1 MerR Not tested SGI1 Protein 5e-25 47
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 1e-25 47
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 1e-25 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SM11_pC1589 YP_005725471.1 Transcriptional regulator, MerR/CueR family BAC0688 Protein 7e-27 48
SM11_pC1589 YP_005725471.1 Transcriptional regulator, MerR/CueR family BAC0686 Protein 9e-26 48
SM11_pC1589 YP_005725471.1 Transcriptional regulator, MerR/CueR family BAC0232 Protein 6e-26 47
SM11_pC1589 YP_005725471.1 Transcriptional regulator, MerR/CueR family BAC0683 Protein 3e-26 47
SM11_pC1589 YP_005725471.1 Transcriptional regulator, MerR/CueR family BAC0684 Protein 7e-27 47
SM11_pC1589 YP_005725471.1 Transcriptional regulator, MerR/CueR family BAC0687 Protein 6e-26 47
SM11_pC1589 YP_005725471.1 Transcriptional regulator, MerR/CueR family BAC0689 Protein 8e-26 47