Gene Information

Name : SM11_pC1330 (SM11_pC1330)
Accession : YP_005725212.1
Strain :
Genome accession: NC_017327
Putative virulence/resistance : Unknown
Product : probabable insertion sequence transposase protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1219569 - 1219916 bp
Length : 348 bp
Strand : -
Note : Transposase and inactivated derivatives

DNA sequence :
ATGATCCCGGTCCCGAGCGGTGTGAGGGTCTGGCTAGCGACGGGCTATACCGACATGCGCAGAGGCTTTCCCGGCCTGTC
ACTGATGGTGCAGGAGACGTTGAAGCGCGATCCGATGAGCGGCCATCTGTTCGTCTTCCGCGGCCGGAGCGGCGGCCTGA
TCAAGGTGATATGGCACGACGGCCAGGGTGCCTGCCTGTTCACGAAGAAGCTCGAGCGCGGCCGTTTCATCTGGCCGTCA
GCGGCCGACGGCACGGTGGTGATCACGCCGGCGCAGCTCGGCTATCTGCTCGAAGGCATCGACTGGCGAATGCCGCAAAA
AACCTGGCGGCCTAGCTCGGCCGGATGA

Protein sequence :
MIPVPSGVRVWLATGYTDMRRGFPGLSLMVQETLKRDPMSGHLFVFRGRSGGLIKVIWHDGQGACLFTKKLERGRFIWPS
AADGTVVITPAQLGYLLEGIDWRMPQKTWRPSSAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-32 65
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-32 65
unnamed AAC31493.1 L0014 Not tested LEE Protein 5e-32 64
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 7e-32 64
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 5e-32 64
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 7e-32 64
unnamed AAL99258.1 unknown Not tested LEE Protein 5e-32 64
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 7e-32 64
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 5e-32 64
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 7e-32 64
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 9e-26 63
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 2e-32 63
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 2e-32 63
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 4e-31 63
unnamed AAL08461.1 unknown Not tested SRL Protein 7e-32 63
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 4e-31 63
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 4e-32 62
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 1e-30 59
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 1e-30 59
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 2e-29 56
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 2e-29 56
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 6e-26 55
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 2e-28 54
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 2e-28 54
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 3e-29 54

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SM11_pC1330 YP_005725212.1 probabable insertion sequence transposase protein VFG1698 Protein 5e-33 65
SM11_pC1330 YP_005725212.1 probabable insertion sequence transposase protein VFG0792 Protein 2e-32 64
SM11_pC1330 YP_005725212.1 probabable insertion sequence transposase protein VFG1709 Protein 2e-32 64
SM11_pC1330 YP_005725212.1 probabable insertion sequence transposase protein VFG1517 Protein 4e-26 63
SM11_pC1330 YP_005725212.1 probabable insertion sequence transposase protein VFG1052 Protein 3e-32 63
SM11_pC1330 YP_005725212.1 probabable insertion sequence transposase protein VFG1665 Protein 2e-32 62
SM11_pC1330 YP_005725212.1 probabable insertion sequence transposase protein VFG1737 Protein 9e-30 54