Gene Information

Name : SinmeB_5556 (SinmeB_5556)
Accession : YP_005717563.1
Strain :
Genome accession: NC_017324
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 487415 - 487819 bp
Length : 405 bp
Strand : +
Note : KEGG: rhi:NGR_c22280 putative transcriptional regulator, MerR family; PFAM: Transcription regulator MerR, DNA binding; HTH transcriptional regulator, MerR; SMART: HTH transcriptional regulator, MerR

DNA sequence :
ATGGTACAGAGTCAAGGCCTTCAAGAACTGACGATCGGAAAACTTGCGGCTGCCGGAGGCGTGGGTGTTGAAACCATCCG
TTTCTACCAGCGCAAGGGCCTGCTGGCGACGCCGAAGCGGTTAGAAGGCGTGCGCCGCTATGGAGGCGAAGACGTGCGCC
GACTACTTTTCATAAAACAGGCGCAGGCGGCCGGTTTCACGCTTGAGGAGATCGGGCAGCTTCTGGCACTGGATGCCGGG
CACAACCGCTCGGCTGCACGGGAACTGGCGAAGAAGAAGCTTGAGCAGCTGGATGCCAGGATTGGAGAGCTTAATCGCGC
CCGGGGAGCACTTCGTAAGCTGGTCTCTGAATGCGCAGAGGACAAGACCGGACCGTGTCCCATCCTGGCTTCCTTTGGAG
TTTGA

Protein sequence :
MVQSQGLQELTIGKLAAAGGVGVETIRFYQRKGLLATPKRLEGVRRYGGEDVRRLLFIKQAQAAGFTLEEIGQLLALDAG
HNRSAARELAKKKLEQLDARIGELNRARGALRKLVSECAEDKTGPCPILASFGV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 6e-24 49
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 2e-24 48
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 2e-25 47
merR ACK44535.1 MerR Not tested SGI1 Protein 1e-24 47
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 1e-24 47
merR AFG30124.1 MerR Not tested PAGI-2 Protein 1e-24 47
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 2e-24 47
merR AGK07025.1 MerR Not tested SGI1 Protein 2e-24 47
merR AGK07083.1 MerR Not tested SGI1 Protein 2e-24 47
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 9e-25 46
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 1e-24 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SinmeB_5556 YP_005717563.1 MerR family transcriptional regulator BAC0683 Protein 1e-25 47
SinmeB_5556 YP_005717563.1 MerR family transcriptional regulator BAC0688 Protein 6e-26 47
SinmeB_5556 YP_005717563.1 MerR family transcriptional regulator BAC0684 Protein 6e-26 47
SinmeB_5556 YP_005717563.1 MerR family transcriptional regulator BAC0686 Protein 9e-25 47
SinmeB_5556 YP_005717563.1 MerR family transcriptional regulator BAC0687 Protein 5e-25 46
SinmeB_5556 YP_005717563.1 MerR family transcriptional regulator BAC0232 Protein 5e-25 46
SinmeB_5556 YP_005717563.1 MerR family transcriptional regulator BAC0689 Protein 8e-25 46