Gene Information

Name : SinmeB_4092 (SinmeB_4092)
Accession : YP_005716205.1
Strain :
Genome accession: NC_017323
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 695198 - 695545 bp
Length : 348 bp
Strand : -
Note : PFAM: Transposase (putative), IS66 Orf2-like; KEGG: smd:Smed_6512 IS66 Orf2 family protein

DNA sequence :
ATGATTGGGCCTTCTGGAAATGTGCGGGTCTATTTGGCTTGCGGGGTGACCGACATGAGGCGTGGCATTGCTGGATTGTC
GGCGTTGGTCGAAGCGGTCATAAAGGAGGCGCCGGGGTCTGGCGCGATCTTCGGGTTCCGCGGCAAACGCGCGGATCGGA
TCAAGCTTCTCTGGTGGGATGGCCAGGGGTTTTGCCTGTTTTACAAGATTTTGGAGCGCGGGTACTTTCCTTGGCCGACG
GCGAAGGATGGTGTTGCCCATCTGACGCAGGCCCAGCTTTCCATGCTCGTTGAGGGGATCGATTGGCGCCGACCGGCGTG
GACTTCCGCTCCTGGCCGAATGGGATAA

Protein sequence :
MIGPSGNVRVYLACGVTDMRRGIAGLSALVEAVIKEAPGSGAIFGFRGKRADRIKLLWWDGQGFCLFYKILERGYFPWPT
AKDGVAHLTQAQLSMLVEGIDWRRPAWTSAPGRMG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 3e-26 53
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 3e-26 53
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 1e-20 53
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 1e-24 53
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-24 53
unnamed AAL99258.1 unknown Not tested LEE Protein 1e-24 53
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 2e-24 53
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 1e-24 53
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 2e-24 53
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 2e-24 53
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-23 53
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-23 53
unnamed AAL08461.1 unknown Not tested SRL Protein 2e-24 53
unnamed AAC31493.1 L0014 Not tested LEE Protein 1e-24 53
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 6e-26 52
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 4e-24 52
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-24 52
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 3e-23 50
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 3e-23 50
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 2e-22 49
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 2e-22 49
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 2e-16 48
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 3e-22 47
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 2e-21 46
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 2e-21 46
Z1163 NP_286698.1 hypothetical protein Not tested TAI Protein 1e-11 41
Z1602 NP_287106.1 hypothetical protein Not tested TAI Protein 1e-11 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SinmeB_4092 YP_005716205.1 IS66 Orf2 family protein VFG1709 Protein 5e-25 53
SinmeB_4092 YP_005716205.1 IS66 Orf2 family protein VFG0792 Protein 5e-25 53
SinmeB_4092 YP_005716205.1 IS66 Orf2 family protein VFG1052 Protein 7e-25 53
SinmeB_4092 YP_005716205.1 IS66 Orf2 family protein VFG1665 Protein 3e-26 52
SinmeB_4092 YP_005716205.1 IS66 Orf2 family protein VFG1698 Protein 1e-24 52
SinmeB_4092 YP_005716205.1 IS66 Orf2 family protein VFG1517 Protein 1e-16 48
SinmeB_4092 YP_005716205.1 IS66 Orf2 family protein VFG1737 Protein 7e-23 47