Gene Information

Name : SinmeB_0635 (SinmeB_0635)
Accession : YP_005712815.1
Strain : Sinorhizobium meliloti BL225C
Genome accession: NC_017322
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 670759 - 671430 bp
Length : 672 bp
Strand : +
Note : KEGG: smd:Smed_0630 two component transcriptional regulator; PFAM: Signal transduction response regulator, receiver domain; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver domain; Signal transduc

DNA sequence : 
ATGCGCATTCTGATCGTCGAGGACGATACCAATCTGAACAGGCAGCTGGCTGACGCTCTGAAGGAGGCCGGTTATGTCGT
CGACCAGGCTTATGACGGCGAAGAGGGCCACTATCTAGGCGATGCGGAGCCCTATGATGCGGTAATTCTCGATATAGGTC
TTCCGGAGATGGACGGCATCACCGTTCTCGAGAAATGGCGCGCAGACGGCAAGACCATGCCGGTGCTGATCCTGACGGCC
CGCGATCGATGGAGCGACAAGGTCGCAGGCATCGATGCCGGCGCCGACGATTATGTGGCGAAGCCTTTCCACGTCGAGGA
GGTGCTGGCCCGCATCCGTGCGTTGATCCGGCGGGCCGCCGGGCACGCAAGCTCCGAGATCGTCTGCGGCCCCGTCCGTC
TCGACACCAAGGGCTCCAAGGCGACCGTCGCTGGCGTCGCGCTGAAGCTCACATCGCACGAGTTCCGTCTGCTTTCCTAC
CTCATGCACCATATGGGACAGGTGGTTTCCCGCACCGAGTTGGTCGAACACATGTATGATCAGGACTTCGATCGCGATTC
CAACACGATCGAGGTTTTCATCGGCCGGCTCCGTAAGAAGATCGGCAACGATCTGATCGAAACGGTGCGCGGCCTCGGAT
ATCGCATGCAAGCACCCGGCAATGGCCATTAG

Protein sequence : 
MRILIVEDDTNLNRQLADALKEAGYVVDQAYDGEEGHYLGDAEPYDAVILDIGLPEMDGITVLEKWRADGKTMPVLILTA
RDRWSDKVAGIDAGADDYVAKPFHVEEVLARIRALIRRAAGHASSEIVCGPVRLDTKGSKATVAGVALKLTSHEFRLLSY
LMHHMGQVVSRTELVEHMYDQDFDRDSNTIEVFIGRLRKKIGNDLIETVRGLGYRMQAPGNGH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-27 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SinmeB_0635 YP_005712815.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 1e-38 47
SinmeB_0635 YP_005712815.1 winged helix family two component transcriptional regulator CP000647.1.gene1136. Protein 7e-37 46
SinmeB_0635 YP_005712815.1 winged helix family two component transcriptional regulator BAC0530 Protein 7e-37 46
SinmeB_0635 YP_005712815.1 winged helix family two component transcriptional regulator CP001918.1.gene2526. Protein 3e-36 45
SinmeB_0635 YP_005712815.1 winged helix family two component transcriptional regulator CP004022.1.gene1005. Protein 3e-40 45
SinmeB_0635 YP_005712815.1 winged helix family two component transcriptional regulator BAC0487 Protein 3e-28 45
SinmeB_0635 YP_005712815.1 winged helix family two component transcriptional regulator CP001138.1.gene1939. Protein 9e-37 44
SinmeB_0635 YP_005712815.1 winged helix family two component transcriptional regulator CP000034.1.gene2022. Protein 8e-37 43
SinmeB_0635 YP_005712815.1 winged helix family two component transcriptional regulator NC_002695.1.913289.p Protein 3e-36 43
SinmeB_0635 YP_005712815.1 winged helix family two component transcriptional regulator BAC0347 Protein 3e-28 42
SinmeB_0635 YP_005712815.1 winged helix family two component transcriptional regulator BAC0111 Protein 8e-32 42
SinmeB_0635 YP_005712815.1 winged helix family two component transcriptional regulator BAC0197 Protein 4e-30 42
SinmeB_0635 YP_005712815.1 winged helix family two component transcriptional regulator BAC0125 Protein 1e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SinmeB_0635 YP_005712815.1 winged helix family two component transcriptional regulator VFG0475 Protein 8e-37 44
SinmeB_0635 YP_005712815.1 winged helix family two component transcriptional regulator VFG0473 Protein 2e-28 43
SinmeB_0635 YP_005712815.1 winged helix family two component transcriptional regulator VFG0596 Protein 7e-28 42
SinmeB_0635 YP_005712815.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-28 41