Gene Information

Name : OG1RF_10783 (OG1RF_10783)
Accession : YP_005707840.1
Strain : Enterococcus faecalis OG1RF
Genome accession: NC_017316
Putative virulence/resistance : Virulence
Product : response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 816066 - 816752 bp
Length : 687 bp
Strand : +
Note : COG: COG0745; Pfam: PF00072,PF00486; InterPro: IPR001789

DNA sequence :
ATGAGCAACATTTTAATTATTGAAGATGAAAAGAACTTAGCGAGATTCGTTGAGCTTGAATTAAAACATGAGGGGTATAC
GACAGAAGTACACTACAATGGTCGTACAGGATTGGAAGCCGCTCTTAACAACGAATGGGATGCTATCCTTCTTGATTTGA
TGTTACCAGAATTAAATGGATTAGAAGTATGTCGCCGTGTTCGCCAAGTGAAAAATACACCAATTATTATGATGACTGCG
CGTGATTCAGTAATTGACCGTGTTTCTGGTTTAGACCATGGAGCGGATGATTATATTGTTAAACCATTTGCAATTGAAGA
ATTGTTAGCTCGTTTACGTGCGTTACTTCGTCGTATTGATATTGAGGGCGATAAAAACGTTGCAAAACAAACAACGATTA
CATATCGTGACTTAACAATTGAAAAAGAAAATCGTGTCGTTCGTCGTAATTCTGAAATGATTGAATTAACAAAACGCGAA
TACGAATTACTATTAACGCTAATGGAAAACGTGAATGTTGTCTTGGCACGTGATGTGTTACTAAATAAAGTTTGGGGCTA
TGAAACAGAAGTAGAAACAAACGTTGTGGATGTGTATATCCGCTACTTACGAAATAAAATTGACGTACCTGGAGAAGAAA
GCTACATCCAAACTGTCCGTGGAACTGGCTACGTTATGCGTTCGTGA

Protein sequence :
MSNILIIEDEKNLARFVELELKHEGYTTEVHYNGRTGLEAALNNEWDAILLDLMLPELNGLEVCRRVRQVKNTPIIMMTA
RDSVIDRVSGLDHGADDYIVKPFAIEELLARLRALLRRIDIEGDKNVAKQTTITYRDLTIEKENRVVRRNSEMIELTKRE
YELLLTLMENVNVVLARDVLLNKVWGYETEVETNVVDVYIRYLRNKIDVPGEESYIQTVRGTGYVMRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-29 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-29 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
OG1RF_10783 YP_005707840.1 response regulator HE999704.1.gene1528. Protein 5e-78 80
OG1RF_10783 YP_005707840.1 response regulator NC_002952.2859858.p0 Protein 2e-49 56
OG1RF_10783 YP_005707840.1 response regulator NC_007622.3794948.p0 Protein 2e-49 56
OG1RF_10783 YP_005707840.1 response regulator NC_003923.1003417.p0 Protein 2e-49 56
OG1RF_10783 YP_005707840.1 response regulator NC_013450.8614146.p0 Protein 2e-49 56
OG1RF_10783 YP_005707840.1 response regulator NC_002951.3238224.p0 Protein 2e-49 56
OG1RF_10783 YP_005707840.1 response regulator NC_007793.3914065.p0 Protein 2e-49 56
OG1RF_10783 YP_005707840.1 response regulator NC_002758.1121390.p0 Protein 2e-49 56
OG1RF_10783 YP_005707840.1 response regulator NC_010079.5776364.p0 Protein 2e-49 56
OG1RF_10783 YP_005707840.1 response regulator AE015929.1.gene1106. Protein 3e-45 54
OG1RF_10783 YP_005707840.1 response regulator BAC0308 Protein 1e-30 42
OG1RF_10783 YP_005707840.1 response regulator BAC0125 Protein 2e-29 42
OG1RF_10783 YP_005707840.1 response regulator NC_012469.1.7685629. Protein 6e-37 41
OG1RF_10783 YP_005707840.1 response regulator BAC0197 Protein 3e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
OG1RF_10783 YP_005707840.1 response regulator VFG1390 Protein 4e-36 44
OG1RF_10783 YP_005707840.1 response regulator VFG0596 Protein 6e-30 43
OG1RF_10783 YP_005707840.1 response regulator VFG1389 Protein 3e-32 43
OG1RF_10783 YP_005707840.1 response regulator VFG1702 Protein 9e-30 41