Gene Information

Name : Deval_1001 (Deval_1001)
Accession : YP_005701803.1
Strain : Desulfovibrio vulgaris RCH1
Genome accession: NC_017310
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1190645 - 1191334 bp
Length : 690 bp
Strand : +
Note : KEGG: dde:Dde_2387 two component transcriptional regulator; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver

DNA sequence :
ATGGCAAAAGAACGGATTCTGGTCGTCGAGGATGACGAGGATATCCTTCAGCTGCTCCGTTTCACGCTCGAGGCGGCCGG
TTTCGAGGTCGTCACGGCCGCCACGGGACGAGACGGGCTCGAGAGCGCGCAGCGGCATGTTCCGGGGCTGGTACTGCTCG
ACCTTATGCTGCCGGGCATGAGCGGTTTCGACGTATGCCGCGAACTCAAGCGCACCCCCGCCACGGAGCATGTACCGGTC
ATCATGCTGACCGCCCGTGGTGAAGAGGTCGACCGCATCGTGGGGCTTGAACTGGGGGCCGACGATTACGTCATCAAACC
CTTCAGCCCGCGTGAACTGGTCTTGCGCATCCGTGCCGTGCTCAAGCGCGTGACAGGGGCGCAAGAGCCTGCACCCCGTG
GACAGTGGAACGTGGACGGGCTGTTTCTCGATGAAGAGGCCCACCGCGTGGAAGTTGACGGTGAAGAGGCGCTGCTTACC
GCGACGGAGTTCAGGTTGCTTGCTGAACTTGTCCGGAACCGTGGGCGTGTCCGCACTCGTGACCAGCTGCTGAACACGGT
GTGGGGCTACGAATTCGAGGGATATGCACGCACGGTCGATACCCATGTGCGTCGCTTGCGCCAGAAGATAGGCCGCTTCG
CCGCCATGATCGAAACGATCAGGGGTGTCGGCTACAGGTTCAAGGAGTAA

Protein sequence :
MAKERILVVEDDEDILQLLRFTLEAAGFEVVTAATGRDGLESAQRHVPGLVLLDLMLPGMSGFDVCRELKRTPATEHVPV
IMLTARGEEVDRIVGLELGADDYVIKPFSPRELVLRIRAVLKRVTGAQEPAPRGQWNVDGLFLDEEAHRVEVDGEEALLT
ATEFRLLAELVRNRGRVRTRDQLLNTVWGYEFEGYARTVDTHVRRLRQKIGRFAAMIETIRGVGYRFKE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 2e-30 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-36 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-45 48
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-41 43
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator NC_010410.6002989.p0 Protein 4e-36 42
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator NC_011595.7057856.p0 Protein 4e-36 42
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-44 42
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-44 42
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-44 42
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-44 42
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-44 42
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-44 42
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-44 42
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-44 42
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-44 42
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-44 42
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 2e-31 42
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 1e-27 42
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator BAC0533 Protein 6e-28 42
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 6e-28 42
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator AF310956.2.orf0.gene Protein 6e-31 41
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-40 41
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-40 41
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-40 41
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-40 41
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-40 41
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-40 41
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-40 41
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-40 41
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator NC_010400.5986590.p0 Protein 2e-35 41
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 8e-28 41
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 8e-28 41
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator BAC0197 Protein 5e-30 41
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-39 41
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator NC_008702.1.4607594. Protein 1e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator VFG1563 Protein 7e-37 41
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator VFG1702 Protein 8e-36 41
Deval_1001 YP_005701803.1 winged helix family two component transcriptional regulator VFG1386 Protein 6e-35 41