Gene Information

Name : cusR (ETAF_1503)
Accession : YP_005699105.1
Strain : Edwardsiella tarda FL6-60
Genome accession: NC_017309
Putative virulence/resistance : Virulence
Product : Copper-sensing two-component system response regulator CusR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1722530 - 1723213 bp
Length : 684 bp
Strand : -
Note : -

DNA sequence :
GTGAAGATACTGATCGTCGAGGATGAGGTGAAAACCGGGAAATACCTGTGTAAGGGGCTGACAGAGGCGGGATTTGTCGT
CGATCTCGCCGACAACGGTTTAACGGGATACCACCTGGCGATGACCGCCGGCTATGATCTGATCATCCTTGATATCCTGC
TGCCCGACGTCAACGGCTGGGAGATCGTCCGCATGCTGCGCAGCGCCAACCAGGGACTGCCGATCCTGCTGCTGAGCGCC
CTCGGCACCATCGAGCAGCGGGTAAAGGGGCTGGAGCTCGGCGCCGACGACTACCTGGTCAAGCCCTTCGCCTTCGCCGA
GCTCTTGGCGCGGGTGAGAACCCTACTGAGACGCGGCAGCCCCCCTATCCCCGAGAGCCAGTTTCACGTCGCCGATCTCA
CCGTGGAGCTCCTTTCCAGAAAGGTGACCCGCGGCGGTAAGCGCATCACGCTAACGGGGAAAGAGTTCACCCTGGTGACG
TTTTTTATCCGTCACCAGGGCGAGGTGCTGCCCCGCTCCCTGATCGCCTCGCAGGTCTGGGACATGAACTTCGACAGCGA
CACCAACGCCATCGACGTGGCCGTGAAGCGGCTGCGGGCGAAGATCGACCTCGACTTCGAACCTAAGCTGATCCAGACGG
TGCGCGGCGTGGGCTACCTGCTCGAGGCGCCGGATGTCGACTAA

Protein sequence :
MKILIVEDEVKTGKYLCKGLTEAGFVVDLADNGLTGYHLAMTAGYDLIILDILLPDVNGWEIVRMLRSANQGLPILLLSA
LGTIEQRVKGLELGADDYLVKPFAFAELLARVRTLLRRGSPPIPESQFHVADLTVELLSRKVTRGGKRITLTGKEFTLVT
FFIRHQGEVLPRSLIASQVWDMNFDSDTNAIDVAVKRLRAKIDLDFEPKLIQTVRGVGYLLEAPDVD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-48 54
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-47 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_005699105.1 Copper-sensing two-component system response regulator CusR BAC0111 Protein 9e-86 87
cusR YP_005699105.1 Copper-sensing two-component system response regulator CusR BAC0347 Protein 3e-77 79
cusR YP_005699105.1 Copper-sensing two-component system response regulator CusR BAC0083 Protein 2e-62 62
cusR YP_005699105.1 Copper-sensing two-component system response regulator CusR BAC0638 Protein 5e-57 60
cusR YP_005699105.1 Copper-sensing two-component system response regulator CusR BAC0197 Protein 4e-56 59
cusR YP_005699105.1 Copper-sensing two-component system response regulator CusR BAC0308 Protein 5e-56 58
cusR YP_005699105.1 Copper-sensing two-component system response regulator CusR BAC0125 Protein 2e-56 54

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_005699105.1 Copper-sensing two-component system response regulator CusR VFG0596 Protein 3e-48 54
cusR YP_005699105.1 Copper-sensing two-component system response regulator CusR VFG1390 Protein 2e-38 43
cusR YP_005699105.1 Copper-sensing two-component system response regulator CusR VFG1389 Protein 2e-28 41