Gene Information

Name : Cp1002_1456 (Cp1002_1456)
Accession : YP_005681720.1
Strain : Corynebacterium pseudotuberculosis 1002
Genome accession: NC_017300
Putative virulence/resistance : Resistance
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1595297 - 1595509 bp
Length : 213 bp
Strand : +
Note : -

DNA sequence :

GTGACCATCACGTTCAAACCTCTGTGGAAACTCCTTAGCGACCGAGAAATGACCAAAGAAGACCTACGCATCGCAACCGG
CTTATCAGCTGCGACCATCGCCAAGATGGGTAAAGACGGCAACGTCACCACAGAGGTTCTTGCCCGAATATGTACGGCAT
TAACGGTAGACATCAATGACATCTGCGAAGCCACCAAGGAGCCAAAGAAATGA

Protein sequence :

MTITFKPLWKLLSDREMTKEDLRIATGLSAATIAKMGKDGNVTTEVLARICTALTVDINDICEATKEPKK

• Homologs from PAI DB

Gene	GenBank Accn	Product	Virulance or Resistance	PAI or REI	Alignment Type	E-val	Identity
Cp1002_1456	YP_005681720.1	hypothetical protein	Not tested	PiCp 5	Protein	2e-26	100
cpfrc_01461	YP_003783861.1	hypothetical protein	Not tested	PiCp 5	Protein	6e-26	99
CpC231_1455	YP_005683818.1	hypothetical protein	Not tested	PiCp 5	Protein	2e-25	98
CpI19_1462	YP_005685904.1	hypothetical protein	Not tested	PiCp 5	Protein	2e-25	98
SPN23F_09520	YP_002510935.1	regulatory protein	Not tested	PPI-1	Protein	8e-08	41
SP_1030	NP_345505.1	hypothetical protein	Not tested	PPI-1	Protein	8e-08	41

• Homologs from CARD and BacMet (resistance genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
Cp1002_1456	YP_005681720.1	hypothetical protein	DQ212986.1.gene3.p01	Protein	3e-11	49