Gene Information

Name : H04402_03509 (H04402_03509)
Accession : YP_005680036.1
Strain : Clostridium botulinum H04402 065
Genome accession: NC_017299
Putative virulence/resistance : Virulence
Product : putative response regulator ArlR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3679733 - 3680416 bp
Length : 684 bp
Strand : -
Note : -

DNA sequence :
TTGAAGAATTTTAAGATCCTTTTAGTAGAATATGAAGAGCAAATGTCAATGTTTATTGAAATGGAGCTTACTCATGAAGG
TTATAAAGTTGATATAGTTTATGACGGAAGAGAAGCTTTAGAGAAAGTGGAAAATACAGAATATCAGTTAATACTTCTTG
ATATTATGATACCAGGTTTAAATGGGATTGAAGTTTGCAGAAGGATTAGGCAATTCTCTTGTGTACCTATAATAATGTTA
ACTACAAAAAGCGGTGTATCGGACAAAGTTTTAGGACTTGACGTTGGGGCTAATGATTATTTAACTAAACCTTTTGCAAT
AGAGGAATTATTGGCAAGAATACGAGTATATGGACGAGAAAAGTTAGTAAAGAGTAAATTTGATGAAGTTAAAGTAAAAG
AGATTGTGATGGATAATAAGACACATCAAGTTTGGAGGTCTGGAAGAGAAATTGAACTTACCAAAAAAGAATATGATCTT
CTCGAAAAGCTGTTAATTAATAAAAACATTGTGCTTACAAGAGAACGATTAATTGAAAAGGTATGGGGCTATGATTATGT
AGGAGATACTAATGTAGTAGATGTATTTATAAGATATTTACGAAGTAAAATTGATAATGATTCTAAAGAGAAGCTTATAA
CTACAATAAGAGGTGTAGGCTATGTTATTAAAGATAAATATTGA

Protein sequence :
MKNFKILLVEYEEQMSMFIEMELTHEGYKVDIVYDGREALEKVENTEYQLILLDIMIPGLNGIEVCRRIRQFSCVPIIML
TTKSGVSDKVLGLDVGANDYLTKPFAIEELLARIRVYGREKLVKSKFDEVKVKEIVMDNKTHQVWRSGREIELTKKEYDL
LEKLLINKNIVLTRERLIEKVWGYDYVGDTNVVDVFIRYLRSKIDNDSKEKLITTIRGVGYVIKDKY

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-37 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-36 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H04402_03509 YP_005680036.1 putative response regulator ArlR NC_007793.3914065.p0 Protein 5e-50 53
H04402_03509 YP_005680036.1 putative response regulator ArlR NC_002758.1121390.p0 Protein 5e-50 53
H04402_03509 YP_005680036.1 putative response regulator ArlR NC_010079.5776364.p0 Protein 5e-50 53
H04402_03509 YP_005680036.1 putative response regulator ArlR NC_002952.2859858.p0 Protein 5e-50 53
H04402_03509 YP_005680036.1 putative response regulator ArlR NC_007622.3794948.p0 Protein 5e-50 53
H04402_03509 YP_005680036.1 putative response regulator ArlR NC_003923.1003417.p0 Protein 5e-50 53
H04402_03509 YP_005680036.1 putative response regulator ArlR NC_013450.8614146.p0 Protein 5e-50 53
H04402_03509 YP_005680036.1 putative response regulator ArlR NC_002951.3238224.p0 Protein 5e-50 53
H04402_03509 YP_005680036.1 putative response regulator ArlR AE015929.1.gene1106. Protein 3e-44 52
H04402_03509 YP_005680036.1 putative response regulator ArlR HE999704.1.gene1528. Protein 2e-44 50
H04402_03509 YP_005680036.1 putative response regulator ArlR BAC0308 Protein 8e-36 43
H04402_03509 YP_005680036.1 putative response regulator ArlR BAC0125 Protein 1e-39 42
H04402_03509 YP_005680036.1 putative response regulator ArlR NC_012469.1.7686381. Protein 3e-38 41
H04402_03509 YP_005680036.1 putative response regulator ArlR NC_012469.1.7685629. Protein 9e-38 41
H04402_03509 YP_005680036.1 putative response regulator ArlR NC_002952.2859905.p0 Protein 3e-37 41
H04402_03509 YP_005680036.1 putative response regulator ArlR NC_007622.3794472.p0 Protein 3e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H04402_03509 YP_005680036.1 putative response regulator ArlR VFG0596 Protein 3e-37 42