Gene Information

Name : H04402_01993 (H04402_01993)
Accession : YP_005678536.1
Strain : Clostridium botulinum H04402 065
Genome accession: NC_017299
Putative virulence/resistance : Resistance
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2118475 - 2119140 bp
Length : 666 bp
Strand : -
Note : -

DNA sequence :
ATGCCAAAGAGAATTCTTGTAGTAGAGGACGATTTTGATATACATACTATTATAAGTGAGGTTCTAAAGGAAAGTGGATA
TTTAGTGGAGGTGGCTACAGATGGATTAATTGCGGTGGAGATGTTTAGAAGGGGGAATTTTGATTTAATAATTTTAGATG
TGATGCTTCCTAAAATAGATGGATTTGTAGTATGTGAAATTATAAGAAAAGAATCAAGTGTGCCTATAATAATGCTTACT
GCTCTAGGGGAAGAGGAGGATGAGATGAAAGGTTTTGAATTAAAAGTAGATGATTATATAACAAAGCCCTTTTCTATTAG
TTTATTAATAAAAAGAGTAGAAGCAGTGCTTAGAAGAGCCAATGGATTAGAGGAAAATAATTCAACTTTAACCTTTGAAG
AAATAACAATATATCCTTCTAATTATAAAACTTTAGTTAATAATAAGGAAATAGAACTAACTTACAAAGAATTTCAGATA
TTAGAAATATTAATATCAAATGTAGGAAGGGTTTTTTCTAGAGAATCTTTATTAAATCAAATATGGGGATATGATTATTT
TGGAGATACCCGTGTTATAGATACTCATATCAAAAATTTAAGACAAAAACTAAACATAGATTATATAAAGACCATAAGGG
GAGTAGGGTATAAAATTGAAAAATAA

Protein sequence :
MPKRILVVEDDFDIHTIISEVLKESGYLVEVATDGLIAVEMFRRGNFDLIILDVMLPKIDGFVVCEIIRKESSVPIIMLT
ALGEEEDEMKGFELKVDDYITKPFSISLLIKRVEAVLRRANGLEENNSTLTFEEITIYPSNYKTLVNNKEIELTYKEFQI
LEILISNVGRVFSRESLLNQIWGYDYFGDTRVIDTHIKNLRQKLNIDYIKTIRGVGYKIEK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 6e-44 44
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-43 44
vanRB YP_001698483.1 regulatory protein Not tested Not named Protein 5e-43 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H04402_01993 YP_005678536.1 two-component response regulator HE999704.1.gene1202. Protein 3e-48 47
H04402_01993 YP_005678536.1 two-component response regulator NC_002952.2859905.p0 Protein 6e-39 45
H04402_01993 YP_005678536.1 two-component response regulator NC_007793.3914279.p0 Protein 5e-39 45
H04402_01993 YP_005678536.1 two-component response regulator NC_007622.3794472.p0 Protein 5e-39 45
H04402_01993 YP_005678536.1 two-component response regulator NC_002745.1124361.p0 Protein 5e-39 45
H04402_01993 YP_005678536.1 two-component response regulator NC_009782.5559369.p0 Protein 5e-39 45
H04402_01993 YP_005678536.1 two-component response regulator NC_002951.3237708.p0 Protein 5e-39 45
H04402_01993 YP_005678536.1 two-component response regulator NC_003923.1003749.p0 Protein 5e-39 45
H04402_01993 YP_005678536.1 two-component response regulator NC_002758.1121668.p0 Protein 5e-39 45
H04402_01993 YP_005678536.1 two-component response regulator NC_009641.5332272.p0 Protein 5e-39 45
H04402_01993 YP_005678536.1 two-component response regulator NC_013450.8614421.p0 Protein 5e-39 45
H04402_01993 YP_005678536.1 two-component response regulator AF310956.2.orf0.gene Protein 2e-44 44
H04402_01993 YP_005678536.1 two-component response regulator U35369.1.gene1.p01 Protein 5e-44 44
H04402_01993 YP_005678536.1 two-component response regulator AE016830.1.gene2255. Protein 5e-44 44
H04402_01993 YP_005678536.1 two-component response regulator NC_012469.1.7685629. Protein 2e-37 43
H04402_01993 YP_005678536.1 two-component response regulator HE999704.1.gene2815. Protein 4e-38 41