|
Name : CBF_0790 (CBF_0790) Accession : YP_005673762.1 Strain : Clostridium botulinum 230613 Genome accession: NC_017297 Putative virulence/resistance : Resistance Product : mercuric transport periplasmic protein Function : - COG functional category : - COG ID : - EC number : - Position : 854825 - 855064 bp Length : 240 bp Strand : + Note : identified by match to protein family HMM PF00403 DNA sequence : ATGCTTTTTAATAAGAAATCCGCAGGAAAAGAAATAGAATTAAAAGTAGAAGGAATGATGTGCAATCATTGCGAAATTGC AGTTAAAGAAGCTCTTCAAAAAGTAGATGGAGTGAAAAAAGTAAAGGTGAGCCATTTTAAGAAAAGAGCCTTTATTACAT TAGAAGAGGGAAAAGATGTTGAAGTTTTTGAATTAATACATGCTGTAAAATCTACGGGTTATGATGCTTCTGAAATATAA Protein sequence : MLFNKKSAGKEIELKVEGMMCNHCEIAVKEALQKVDGVKKVKVSHFKKRAFITLEEGKDVEVFELIHAVKSTGYDASEI |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| merP | CAJ77062.1 | Periplasmic mercuric ion binding protein | Not tested | AbaR1 | Protein | 5e-08 | 43 |
| merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 4e-07 | 43 |
| merP | ACN81007.1 | MerP periplasmic mercuric ion binding protein | Not tested | AbaR5 | Protein | 7e-08 | 43 |
| merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 3e-07 | 43 |
| merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 3e-07 | 43 |
| merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 3e-07 | 43 |
| merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 3e-07 | 43 |
| merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 3e-07 | 43 |
| merP | AAN62179.1 | periplasmic mercuric ion binding protein MerP | Not tested | PAGI-2(C) | Protein | 2e-07 | 43 |
| unnamed | ABR13399.1 | copper-transporting ATPase 2 | Not tested | PAGI-5 | Protein | 4e-08 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| CBF_0790 | YP_005673762.1 | mercuric transport periplasmic protein | BAC0085 | Protein | 0.005 | 41 |
