Gene Information

Name : TCCBUS3UF1_5420 (TCCBUS3UF1_5420)
Accession : YP_005653664.1
Strain : Thermus sp. CCB_US3_UF1
Genome accession: NC_017278
Putative virulence/resistance : Virulence
Product : Two component transcriptional regulator, winged helix
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 538370 - 539044 bp
Length : 675 bp
Strand : -
Note : similar to Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain COG0745; similar to Two component transcriptional regulator, winged helix family of Thermaceae UniRef RepID=D3PQY4_MEIRD

DNA sequence :
ATGGAACCCCCCCTCATCCTCATCGTAGAGGACGAGAAGGACATCGCCCGCTTCATCGAGCTGGAGCTGCAGGCGGAGGG
CTACCGCACCGAGGTGGCCCACGACGGGATCACCGGGCTTTCCCGCTTCCGCGAGGTGAACCCCAACCTGGTGATCCTGG
ACCTGATGCTCCCCGTCATGGACGGGATTGAGGTGGCCAAGCGCATCCGCAAGACCTCCAACGTGCCCATCCTGATCCTC
ACCGCCAAGGACCGGGTGGAGGACAAGGTGGAGGGGCTGGACGCCGGGGCCGACGACTACTTGGTGAAGCCCTTCTCCAT
AGAGGAACTCCTGGCCCGGGTGCGGGCCCACCTGCGCCGGGTCAGCCCAGCCATCACCGGGGAGATCCGGGTGGCGGACC
TGATCATCAACCTCGAGGGGCGGGAGGTCTTCCGCTCCGGGCGGCGGATTGAGCTCTCCAACAAGGAGTTTGAGCTCCTG
GAGCTTTTGGCCAAGAACCCGGGCAAGGTCTTCAGCCGCTACGAGATCGAGGAGAAGGTCTGGCCGGGCTACCAAGGGGG
GAGCAACGTGGTGGACGTGTACATCGGCTACCTGCGCAAGAAGCTGGAGGCTGGTGGGGAGCGCCGCCTCATCCACACGG
TGCGGGGCGTGGGGTACGTCTTGCGGGAGGACTAG

Protein sequence :
MEPPLILIVEDEKDIARFIELELQAEGYRTEVAHDGITGLSRFREVNPNLVILDLMLPVMDGIEVAKRIRKTSNVPILIL
TAKDRVEDKVEGLDAGADDYLVKPFSIEELLARVRAHLRRVSPAITGEIRVADLIINLEGREVFRSGRRIELSNKEFELL
ELLAKNPGKVFSRYEIEEKVWPGYQGGSNVVDVYIGYLRKKLEAGGERRLIHTVRGVGYVLRED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-31 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-30 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix NC_003923.1003417.p0 Protein 8e-37 50
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix NC_013450.8614146.p0 Protein 8e-37 50
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix NC_002951.3238224.p0 Protein 8e-37 50
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix NC_007793.3914065.p0 Protein 8e-37 50
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix NC_002758.1121390.p0 Protein 8e-37 50
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix NC_010079.5776364.p0 Protein 8e-37 50
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix NC_002952.2859858.p0 Protein 8e-37 50
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix NC_007622.3794948.p0 Protein 8e-37 50
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix HE999704.1.gene1528. Protein 3e-39 50
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix BAC0125 Protein 6e-39 48
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix AE015929.1.gene1106. Protein 3e-33 46
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix NC_012469.1.7685629. Protein 2e-30 46
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix BAC0308 Protein 2e-36 45
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix BAC0197 Protein 2e-33 45
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix AE000516.2.gene3505. Protein 1e-33 45
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix AF155139.2.orf0.gene Protein 3e-31 43
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix BAC0111 Protein 2e-34 43
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix BAC0083 Protein 9e-34 43
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix NC_002952.2859905.p0 Protein 1e-30 43
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix NC_002758.1121668.p0 Protein 1e-30 43
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix NC_009641.5332272.p0 Protein 1e-30 43
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix NC_013450.8614421.p0 Protein 1e-30 43
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix NC_007793.3914279.p0 Protein 1e-30 43
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix NC_003923.1003749.p0 Protein 2e-30 43
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix NC_007622.3794472.p0 Protein 9e-31 43
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix NC_002745.1124361.p0 Protein 1e-30 43
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix NC_009782.5559369.p0 Protein 1e-30 43
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix NC_002951.3237708.p0 Protein 1e-30 43
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix BAC0638 Protein 4e-28 43
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix BAC0347 Protein 2e-29 42
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix Y16952.3.orf35.gene. Protein 8e-21 41
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix HE999704.1.gene2815. Protein 6e-31 41
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix U82965.2.orf14.gene. Protein 8e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix VFG1390 Protein 2e-44 50
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix VFG1389 Protein 2e-36 45
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix VFG0596 Protein 3e-31 44
TCCBUS3UF1_5420 YP_005653664.1 Two component transcriptional regulator, winged helix VFG1386 Protein 2e-36 43