Name : TCCBUS3UF1_19440 (TCCBUS3UF1_19440) Accession : YP_005655056.1 Strain : Thermus sp. CCB_US3_UF1 Genome accession: NC_017278 Putative virulence/resistance : Resistance Product : heavy metal transport/detoxification protein Function : - COG functional category : - COG ID : - EC number : - Position : 1954573 - 1954773 bp Length : 201 bp Strand : + Note : similar to putative mercuric reductase PRK13748; similar to Heavy metal transport/detoxification protein of Truepera radiovictrix DSM 17093 UniRef RepID=D7CSQ2_9DEIN DNA sequence : ATGGTGAGGCTCAAGGTGGAAGGGATGACCTGCAACCACTGCGCGATGGCGGTGAAGAAGGCCCTCTTGCGCACCCCCGG GGTGGAGCGGGCCGAGGTGAGCCTGGAAAGGGGCGAGGCCGTGGTGGAGGGGAAGGCGGACCCCATGGCCCTGGTCCGGG CGGTGGAGGAGGAAGGCTACCGGGCCTCCCTGGCGGGGTAG Protein sequence : MVRLKVEGMTCNHCAMAVKKALLRTPGVERAEVSLERGEAVVEGKADPMALVRAVEEEGYRASLAG |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
unnamed | ABR13399.1 | copper-transporting ATPase 2 | Not tested | PAGI-5 | Protein | 2e-10 | 45 |
merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 2e-08 | 43 |
merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 1e-08 | 43 |
merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 1e-08 | 43 |
merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 1e-08 | 43 |
merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 1e-08 | 43 |
merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 1e-08 | 43 |
merP | ACN81007.1 | MerP periplasmic mercuric ion binding protein | Not tested | AbaR5 | Protein | 2e-09 | 41 |
merP | CAJ77062.1 | Periplasmic mercuric ion binding protein | Not tested | AbaR1 | Protein | 1e-09 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
TCCBUS3UF1_19440 | YP_005655056.1 | heavy metal transport/detoxification protein | BAC0231 | Protein | 9e-09 | 41 |