Gene Information

Name : Ththe16_0241 (Ththe16_0241)
Accession : YP_005639799.1
Strain : Thermus thermophilus SG0.5JP17-16
Genome accession: NC_017272
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 226518 - 227189 bp
Length : 672 bp
Strand : +
Note : KEGG: phoB; phosphate regulon transcriptional regulatory protein PhoB; PFAM: Signal transduction response regulator, C-terminal; Signal transduction response regulator, receiver region; SMART: Signal transduction response regulator, receiver region

DNA sequence : 
GTGGCCACCCTGCTTCTGGTGGAGGACGAGCCCAGCCTGCGCCTGGGGTTGCGGCTGGCCCTCGAGGGGGCGGGGCACCG
GGTTTTGGAGGCGGCCACCGCGCGGGAGGCCTGGCCCCTCCTGCGGGAGGCGGAGCTCGTGGTCCTGGACTGGATGCTCC
CCGACGAGCCCGGGGTGCGCCTCCTGGACCGGATGCGCCAGGGCCCCTACGAGTCCCTCCCCGTCCTGATGCTCACGGCC
CGGGCCGGGGTGCGGGACCGGGTGGAGGGGCTTTCCCGCGGGGCCGACGACTACCTGGTGAAGCCCTTCGCCGTGGAGGA
GCTTCTGGCCCGCCTCGAGGCCCTCTTGCGCCGGGCGGGGAAGCGCAAGGTGCTGAGGCGGGGCCCCCTCCTCCTGGACC
TGGAGCGGATGGAAGCCCGCCTGGAAGGCAACCCCCTCCCCCTCACCCGGCGGGAGTTTGCCCTCCTCGCCTACCTGGCG
GAGCGGCCGGGCCGGGTCTGCACCCGGGAGGAGCTCCTGGAGGCGGTCTGGGGCCCGGACTACCTCGGCACCCCCAGGAC
CGTGGACCAGCACGTCCTCCAGCTCAGGGAGAAGCTCGGGGAGGACCCCAAGGCCCCCCGCTTCCTGGAGACGGTGCGGG
GCGTGGGGTACCGCTTCCGGGAGGGGGCGTGA

Protein sequence : 
MATLLLVEDEPSLRLGLRLALEGAGHRVLEAATAREAWPLLREAELVVLDWMLPDEPGVRLLDRMRQGPYESLPVLMLTA
RAGVRDRVEGLSRGADDYLVKPFAVEELLARLEALLRRAGKRKVLRRGPLLLDLERMEARLEGNPLPLTRREFALLAYLA
ERPGRVCTREELLEAVWGPDYLGTPRTVDQHVLQLREKLGEDPKAPRFLETVRGVGYRFREGA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 9e-17 44
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-16 42
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-17 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ththe16_0241 YP_005639799.1 winged helix family two component transcriptional regulator EU250284.1.orf4.gene Protein 8e-26 44
Ththe16_0241 YP_005639799.1 winged helix family two component transcriptional regulator BAC0197 Protein 5e-20 44
Ththe16_0241 YP_005639799.1 winged helix family two component transcriptional regulator AE016830.1.gene2255. Protein 5e-17 42
Ththe16_0241 YP_005639799.1 winged helix family two component transcriptional regulator U35369.1.gene1.p01 Protein 5e-17 42
Ththe16_0241 YP_005639799.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 4e-16 42
Ththe16_0241 YP_005639799.1 winged helix family two component transcriptional regulator BAC0487 Protein 8e-18 41
Ththe16_0241 YP_005639799.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 6e-19 41
Ththe16_0241 YP_005639799.1 winged helix family two component transcriptional regulator AF162694.1.orf4.gene Protein 2e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ththe16_0241 YP_005639799.1 winged helix family two component transcriptional regulator VFG0473 Protein 4e-20 45
Ththe16_0241 YP_005639799.1 winged helix family two component transcriptional regulator VFG1390 Protein 6e-18 43
Ththe16_0241 YP_005639799.1 winged helix family two component transcriptional regulator VFG1389 Protein 9e-21 43
Ththe16_0241 YP_005639799.1 winged helix family two component transcriptional regulator VFG0596 Protein 9e-18 41
Ththe16_0241 YP_005639799.1 winged helix family two component transcriptional regulator VFG1386 Protein 2e-18 41