Gene Information

Name : BJ6T_66470 (BJ6T_66470)
Accession : YP_005611484.1
Strain : Bradyrhizobium japonicum USDA 6
Genome accession: NC_017249
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 6801326 - 6802000 bp
Length : 675 bp
Strand : -
Note : -

DNA sequence : 
GTGCGCCTGCTTGTTGTTGAGGACGACCCTGATCTCAATCGCCAGCTCACCAAGGCGCTGACGGACGCCGGCTATGTCGT
CGACCGCGCCTTCGACGGAGAGGAGGGGCACTATCTCGGCGACAACGAGCCCTACGATGCCGTTGTGCTCGACATCGGCC
TGCCCAAGAAGGACGGCATCTCGGTGCTGGAAGCCTGGCGCCGCAACGGCCGCACCATGCCGGTCCTGATCCTCACCGCC
CGCGATCGCTGGAGCGACAAGGTCCAGGGGTTCGATGCCGGCGCCGACGATTACGTGCCGAAGCCGTTCCATCTGGAGGA
GGTGCTGGCGCGCATCCGCGCGCTGCTGCGCCGCTCCACCGGCCATGCCCAGAGCGAATTGAGTTGCGGCCCCGTCACGC
TCGACACCAGGACCGGGCGGGTCAGCGTCTCCGGCAATCCCGTCAAGATGACCTCGCACGAATATCGGCTTCTGGCCTAT
CTGATGCACCATTCGGGGCGCGTCGTGTCCCGCACCGAGCTGGTCGAACACCTCTACGACCAGGACTTCGACCGCGACTC
CAACACCATCGAGGTCTTCGTCGGCCGCATCCGCAAGAAGCTCGATGTCGACATCATCCAGACCGTCCGCGGCCTCGGCT
ATCTCCTGACCCCGCCGCCTGCTCCCGGCGCTTGA

Protein sequence : 
MRLLVVEDDPDLNRQLTKALTDAGYVVDRAFDGEEGHYLGDNEPYDAVVLDIGLPKKDGISVLEAWRRNGRTMPVLILTA
RDRWSDKVQGFDAGADDYVPKPFHLEEVLARIRALLRRSTGHAQSELSCGPVTLDTRTGRVSVSGNPVKMTSHEYRLLAY
LMHHSGRVVSRTELVEHLYDQDFDRDSNTIEVFVGRIRKKLDVDIIQTVRGLGYLLTPPPAPGA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 1e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BJ6T_66470 YP_005611484.1 two-component response regulator NC_002516.2.879194.p Protein 1e-45 48
BJ6T_66470 YP_005611484.1 two-component response regulator CP000647.1.gene1136. Protein 1e-41 46
BJ6T_66470 YP_005611484.1 two-component response regulator BAC0530 Protein 9e-42 46
BJ6T_66470 YP_005611484.1 two-component response regulator CP001918.1.gene2526. Protein 2e-40 45
BJ6T_66470 YP_005611484.1 two-component response regulator NC_002695.1.913289.p Protein 3e-41 44
BJ6T_66470 YP_005611484.1 two-component response regulator CP000034.1.gene2022. Protein 1e-41 44
BJ6T_66470 YP_005611484.1 two-component response regulator CP001138.1.gene1939. Protein 9e-42 44
BJ6T_66470 YP_005611484.1 two-component response regulator CP004022.1.gene1005. Protein 6e-43 44
BJ6T_66470 YP_005611484.1 two-component response regulator BAC0487 Protein 2e-35 43
BJ6T_66470 YP_005611484.1 two-component response regulator BAC0347 Protein 1e-33 42
BJ6T_66470 YP_005611484.1 two-component response regulator BAC0111 Protein 2e-37 41
BJ6T_66470 YP_005611484.1 two-component response regulator BAC0125 Protein 2e-35 41
BJ6T_66470 YP_005611484.1 two-component response regulator BAC0638 Protein 1e-31 41
BJ6T_66470 YP_005611484.1 two-component response regulator BAC0083 Protein 3e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BJ6T_66470 YP_005611484.1 two-component response regulator VFG0475 Protein 8e-42 44
BJ6T_66470 YP_005611484.1 two-component response regulator VFG1390 Protein 1e-34 42
BJ6T_66470 YP_005611484.1 two-component response regulator VFG0473 Protein 2e-33 41