Gene Information

Name : BJ6T_00380 (BJ6T_00380)
Accession : YP_005604927.1
Strain : Bradyrhizobium japonicum USDA 6
Genome accession: NC_017249
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 33302 - 33658 bp
Length : 357 bp
Strand : +
Note : -

DNA sequence :
ATGATCCCGATCCCGAGCGGCGTCAGGGTCTGGATCGCCACCGGCCACACCGACATGCGCCGCGGGATGCAAAGCCTGGC
GCTTGCGGTCCAGGAGAGCCTGAAGCGCGATCCTCATGCTGGCGATCTCTACATCTTCCGGGGTCGCCGCGGCGATCTGG
TCAAGATCCTCTGGCATGACGGGCTGGGCATGTCGCTCTACGCCAAGCGCCTGGATCGCGGCAAGTTCATATGGCCTTCG
GCGTCGGACGGCGCAGTATCGATCTCGGCGGCGCAGATGGGTCCAGAAACTAAAGGTCCCAAACGTGAAAATCCTAAACA
TCTCGAATTTTTCAGAAGGACTCTTGGCTGTCGATAG

Protein sequence :
MIPIPSGVRVWIATGHTDMRRGMQSLALAVQESLKRDPHAGDLYIFRGRRGDLVKILWHDGLGMSLYAKRLDRGKFIWPS
ASDGAVSISAAQMGPETKGPKRENPKHLEFFRRTLGCR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 1e-21 54
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 2e-20 52
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 3e-23 52
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 1e-22 52
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 3e-23 52
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 1e-22 52
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-23 50
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 3e-23 50
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 3e-23 50
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-22 50
unnamed AAL08461.1 unknown Not tested SRL Protein 4e-23 50
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 3e-23 50
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-22 50
unnamed AAC31493.1 L0014 Not tested LEE Protein 2e-23 50
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 2e-23 50
unnamed AAL99258.1 unknown Not tested LEE Protein 2e-23 50
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-23 50
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 2e-23 50
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-23 50
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 2e-25 49
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 2e-25 49
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 2e-25 49
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 4e-23 49
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 3e-24 47
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 3e-24 47

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BJ6T_00380 YP_005604927.1 hypothetical protein VFG1517 Protein 5e-22 54
BJ6T_00380 YP_005604927.1 hypothetical protein VFG1709 Protein 9e-24 50
BJ6T_00380 YP_005604927.1 hypothetical protein VFG1052 Protein 2e-23 50
BJ6T_00380 YP_005604927.1 hypothetical protein VFG0792 Protein 9e-24 50
BJ6T_00380 YP_005604927.1 hypothetical protein VFG1698 Protein 6e-24 50
BJ6T_00380 YP_005604927.1 hypothetical protein VFG1665 Protein 7e-26 49
BJ6T_00380 YP_005604927.1 hypothetical protein VFG1737 Protein 1e-23 49