Gene Information

Name : CT43_CH4691 (CT43_CH4691)
Accession : YP_005574642.1
Strain : Bacillus thuringiensis CT-43
Genome accession: NC_017208
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4650483 - 4651172 bp
Length : 690 bp
Strand : -
Note : -

DNA sequence :
TTGAAAAGAATTTTACTAATAGAAGATGAAGTAAGTATTGCAGAATTACAGCGAGATTATTTAGAAATTAATGATTTCCA
AGTTGATGTAGAGCATTCAGGAGAAACAGGTTTACAAATAGCCCTGCAAGAAGAATATGATTTAATTATTTTAGATATTA
TGCTCCCGAAAATGAACGGATTCGAAATTTGTAAACAAATACGTGCTGTAAAAGATATTCCGATTCTACTTGTTTCAGCA
AAAAAAGAAGATATAGATAAAATTCGCGGACTCGGATTAGGAGCGGATGATTATATAACGAAACCGTTTAGCCCAAGCGA
ATTAGTCGCAAGAGTAAAAGCTCATATTGCTCGTTATGAAAGATTATCAGGAAATGTAAGTAAGCAACGTGATACGTTAT
ATATTCACGGAATTTCTATCGATCAACGAGCGAGGAAAGTTTTTATAAACAATGAAGAAGTGGCATTTACAACGAAGGAA
TTTGATTTATTAACATTCTTTGTCACACATCCAAACCAAGTATTAAATAAAGAACAGTTATTTGAACGCATTTGGGGATT
AGATTCCGCTGGTGATTTAGCCACTGTTGTCGTCCACATTAGAAAGCTACGTGAAAAAATTGAAAGAGATCCTGCCCACC
CACAATATATTGAAACAGTATGGGGAGCTGGTTATCGTTTTAATGTGTAG

Protein sequence :
MKRILLIEDEVSIAELQRDYLEINDFQVDVEHSGETGLQIALQEEYDLIILDIMLPKMNGFEICKQIRAVKDIPILLVSA
KKEDIDKIRGLGLGADDYITKPFSPSELVARVKAHIARYERLSGNVSKQRDTLYIHGISIDQRARKVFINNEEVAFTTKE
FDLLTFFVTHPNQVLNKEQLFERIWGLDSAGDLATVVVHIRKLREKIERDPAHPQYIETVWGAGYRFNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-42 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-41 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CT43_CH4691 YP_005574642.1 two-component response regulator AE016830.1.gene1681. Protein 6e-47 46
CT43_CH4691 YP_005574642.1 two-component response regulator FJ349556.1.orf0.gene Protein 9e-44 44
CT43_CH4691 YP_005574642.1 two-component response regulator AM180355.1.gene1830. Protein 4e-40 44
CT43_CH4691 YP_005574642.1 two-component response regulator NC_012469.1.7686381. Protein 7e-40 43
CT43_CH4691 YP_005574642.1 two-component response regulator AE015929.1.gene1106. Protein 2e-33 42
CT43_CH4691 YP_005574642.1 two-component response regulator NC_007793.3914065.p0 Protein 3e-37 42
CT43_CH4691 YP_005574642.1 two-component response regulator NC_002758.1121390.p0 Protein 3e-37 42
CT43_CH4691 YP_005574642.1 two-component response regulator NC_010079.5776364.p0 Protein 3e-37 42
CT43_CH4691 YP_005574642.1 two-component response regulator NC_002952.2859858.p0 Protein 3e-37 42
CT43_CH4691 YP_005574642.1 two-component response regulator NC_007622.3794948.p0 Protein 3e-37 42
CT43_CH4691 YP_005574642.1 two-component response regulator NC_003923.1003417.p0 Protein 3e-37 42
CT43_CH4691 YP_005574642.1 two-component response regulator NC_013450.8614146.p0 Protein 3e-37 42
CT43_CH4691 YP_005574642.1 two-component response regulator NC_002951.3238224.p0 Protein 3e-37 42
CT43_CH4691 YP_005574642.1 two-component response regulator AF155139.2.orf0.gene Protein 5e-44 42
CT43_CH4691 YP_005574642.1 two-component response regulator HE999704.1.gene2815. Protein 7e-41 42
CT43_CH4691 YP_005574642.1 two-component response regulator NC_002952.2859905.p0 Protein 3e-41 41
CT43_CH4691 YP_005574642.1 two-component response regulator NC_009641.5332272.p0 Protein 4e-41 41
CT43_CH4691 YP_005574642.1 two-component response regulator NC_013450.8614421.p0 Protein 4e-41 41
CT43_CH4691 YP_005574642.1 two-component response regulator NC_007793.3914279.p0 Protein 4e-41 41
CT43_CH4691 YP_005574642.1 two-component response regulator NC_002745.1124361.p0 Protein 4e-41 41
CT43_CH4691 YP_005574642.1 two-component response regulator NC_009782.5559369.p0 Protein 4e-41 41
CT43_CH4691 YP_005574642.1 two-component response regulator AF130997.1.orf0.gene Protein 2e-36 41
CT43_CH4691 YP_005574642.1 two-component response regulator NC_002951.3237708.p0 Protein 4e-41 41
CT43_CH4691 YP_005574642.1 two-component response regulator NC_003923.1003749.p0 Protein 4e-41 41
CT43_CH4691 YP_005574642.1 two-component response regulator NC_002758.1121668.p0 Protein 4e-41 41
CT43_CH4691 YP_005574642.1 two-component response regulator NC_007622.3794472.p0 Protein 3e-41 41
CT43_CH4691 YP_005574642.1 two-component response regulator EU250284.1.orf4.gene Protein 3e-40 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CT43_CH4691 YP_005574642.1 two-component response regulator VFG1563 Protein 5e-43 41
CT43_CH4691 YP_005574642.1 two-component response regulator VFG1702 Protein 7e-42 41