Gene Information

Name : CT43_CH0247 (CT43_CH0247)
Accession : YP_005570231.1
Strain : Bacillus thuringiensis CT-43
Genome accession: NC_017208
Putative virulence/resistance : Resistance
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 268564 - 269265 bp
Length : 702 bp
Strand : +
Note : -

DNA sequence :
GTGGCACACGAAACAATACTTGTCGTAGATGATGAAAAAGAAATTCGGAATTTAATTACAATCTATTTAAAGAATGAAGG
ATATAAAGTATTACAAGCAGGGGACGGAGAAGAAGGGCTACGTTTACTGGAAGAAAATGAAGTGCATCTAGTCGTATTAG
ATATTATGATGCCGAAAGTAGATGGTATTCATATGTGTATGAAAGTAAGAGAATCGAAAGAGATGCCTATTATTATGCTT
TCTGCGAAAACGCAAGATATGGATAAGATTTTAGGATTAACAACAGGAGCAGATGATTACGTAACGAAGCCCTTTAATCC
ATTAGAGTTAATTGCACGAATTAAATCTCAGTTACGCCGTTATATGAAAATGAATGGTTTTGCTATTCAAAATGAGGACG
AGCTAGAAATTGGAGAGATGAAAATAAATATCTCGACCCATAAAGTTATTGTAGAGGGAGAAGAAGTGAAACTAACCCCG
AGGGAATTTTCAATTTTAGAATTGCTAGCTAGAAATCCAGGTATGGTGTTTAGTGCGGAGCAAATTTATGAAAAGGTGTG
GAACGAACGATCTTTCCAGTCTGATAATACTGTAATGGTGCATATTCGAAAAGTACGTGAAAAGATTGAGGAGAATCCAA
GGAAGCCTAGATATATAAAAACAGTATGGGGAGTGGGGTATAAGATTGAAAAAGATATTTAA

Protein sequence :
MAHETILVVDDEKEIRNLITIYLKNEGYKVLQAGDGEEGLRLLEENEVHLVVLDIMMPKVDGIHMCMKVRESKEMPIIML
SAKTQDMDKILGLTTGADDYVTKPFNPLELIARIKSQLRRYMKMNGFAIQNEDELEIGEMKINISTHKVIVEGEEVKLTP
REFSILELLARNPGMVFSAEQIYEKVWNERSFQSDNTVMVHIRKVREKIEENPRKPRYIKTVWGVGYKIEKDI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
sboR YP_006309915.1 SboR Not tested FWisland_1 Protein 2e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CT43_CH0247 YP_005570231.1 two-component response regulator AM180355.1.gene1830. Protein 2e-52 54
CT43_CH0247 YP_005570231.1 two-component response regulator DQ212986.1.gene4.p01 Protein 7e-51 54
CT43_CH0247 YP_005570231.1 two-component response regulator AF130997.1.orf0.gene Protein 3e-51 53
CT43_CH0247 YP_005570231.1 two-component response regulator AF155139.2.orf0.gene Protein 1e-52 50
CT43_CH0247 YP_005570231.1 two-component response regulator NC_014475.1.orf0.gen Protein 1e-50 50
CT43_CH0247 YP_005570231.1 two-component response regulator AF162694.1.orf4.gene Protein 2e-46 50
CT43_CH0247 YP_005570231.1 two-component response regulator NC_005054.2598277.p0 Protein 1e-50 50
CT43_CH0247 YP_005570231.1 two-component response regulator FJ349556.1.orf0.gene Protein 6e-48 49
CT43_CH0247 YP_005570231.1 two-component response regulator EU250284.1.orf4.gene Protein 7e-44 47
CT43_CH0247 YP_005570231.1 two-component response regulator AF253562.2.orf0.gene Protein 1e-32 47
CT43_CH0247 YP_005570231.1 two-component response regulator NC_002952.2859905.p0 Protein 7e-36 43
CT43_CH0247 YP_005570231.1 two-component response regulator NC_009782.5559369.p0 Protein 6e-36 43
CT43_CH0247 YP_005570231.1 two-component response regulator NC_002951.3237708.p0 Protein 6e-36 43
CT43_CH0247 YP_005570231.1 two-component response regulator NC_007622.3794472.p0 Protein 6e-36 43
CT43_CH0247 YP_005570231.1 two-component response regulator NC_002758.1121668.p0 Protein 6e-36 43
CT43_CH0247 YP_005570231.1 two-component response regulator NC_009641.5332272.p0 Protein 6e-36 43
CT43_CH0247 YP_005570231.1 two-component response regulator NC_013450.8614421.p0 Protein 6e-36 43
CT43_CH0247 YP_005570231.1 two-component response regulator NC_007793.3914279.p0 Protein 6e-36 43
CT43_CH0247 YP_005570231.1 two-component response regulator NC_003923.1003749.p0 Protein 6e-36 43
CT43_CH0247 YP_005570231.1 two-component response regulator NC_002745.1124361.p0 Protein 6e-36 43
CT43_CH0247 YP_005570231.1 two-component response regulator NC_012469.1.7685629. Protein 7e-34 43
CT43_CH0247 YP_005570231.1 two-component response regulator HE999704.1.gene2815. Protein 7e-36 42
CT43_CH0247 YP_005570231.1 two-component response regulator AE000516.2.gene3505. Protein 5e-33 41
CT43_CH0247 YP_005570231.1 two-component response regulator CP000034.1.gene3671. Protein 2e-35 41