Gene Information

Name : YBT020_04165 (YBT020_04165)
Accession : YP_005564497.1
Strain : Bacillus thuringiensis YBT-020
Genome accession: NC_017200
Putative virulence/resistance : Resistance
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 884964 - 885227 bp
Length : 264 bp
Strand : +
Note : COG1937 Uncharacterized protein conserved in bacteria

DNA sequence :
GTGGAATACAATCAAGACATGAAAAATAGATTAAAACGTATTGAAGGCCAAGTTCGTGGTGTGCTTCGTATGATGGAAGA
AGGAAAAGATTGCCGAGAGGTTATTACACAGTTAACGGCATCTCGTTCTGCACTTGATCGTACAATTGGACTTGTTGTTG
GAACAAATCTAGAGCAATGTTTACGTGAGCAGTTTGAAAAAGGTAACGGTTCAAATGAAGAGTTAATTAAAGAAGCTGTT
CAATTACTTGTAAAAAGCCGATAA

Protein sequence :
MEYNQDMKNRLKRIEGQVRGVLRMMEEGKDCREVITQLTASRSALDRTIGLVVGTNLEQCLREQFEKGNGSNEELIKEAV
QLLVKSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed BAC57484.1 hypothetical protein Not tested Type-IIIinv SCCmec Protein 4e-19 50
unnamed BAA82210.2 - Not tested Type-II SCCmec Protein 4e-19 50
SAV0048 NP_370572.1 hypothetical protein Not tested Type-II SCCmec Protein 6e-19 50
unnamed BAA82170.2 - Not tested Type-II SCCmec Protein 2e-19 50
SA0045 NP_373285.1 hypothetical protein Not tested Type-II SCCmec Protein 6e-19 50
SERP2514 YP_190056.1 hypothetical protein Not tested Type-II SCCmec Protein 6e-19 50
SAR0047 YP_039520.1 hypothetical protein Not tested Type-II SCCmec Protein 5e-19 50
unnamed BAB47614.1 hypothetical protein Not tested Type-III SCCmec Protein 4e-19 50
unnamed BAA86632.1 hypothetical protein Not tested Type-I SCCmec Protein 7e-20 50
SAPIG0063 YP_005732873.1 conserved protein YrkD Not tested Type-V SCCmec Protein 3e-18 48
SACOL0048 YP_184958.1 hypothetical protein Not tested Type-I SCCmec Protein 2e-18 48
unnamed BAB83476.1 - Not tested SCC 12263 Protein 4e-16 47
unnamed BAA94324.1 hypothetical protein Not tested Type-I SCCmec Protein 3e-16 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
YBT020_04165 YP_005564497.1 hypothetical protein BAC0333 Protein 2e-09 41