Gene Information

Name : YBT020_22300 (YBT020_22300)
Accession : YP_005568106.1
Strain : Bacillus thuringiensis YBT-020
Genome accession: NC_017200
Putative virulence/resistance : Resistance
Product : two-component response regulator ycbL
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4344748 - 4345440 bp
Length : 693 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGTCACATCATATTTTATTAGTTGAAGATGATATTTCAATTCAAGAGATGGTGGAAAAGTATTTAATAAAAGAAGGATT
TCAAGTAACAATTGCGTCTGATGGAGAAGAGGGCGTGAATACATATTTAAAAGGTTCATTTGATTTGATTATCCTCGACA
TTATGATGCCGAAGTTAGATGGCTTAGAGGTTGTGCGAATCATTCGAGAAAAGAGTGCTGTTCCGATTTTAATGATGTCG
GCAAAAGATACAGATGTTGATAAAGCTGTTGGATTAGGACTTGGAGCAGATGATTACATTTGTAAGCCATTTTCTATGAT
TGAATTAGCTGCACGTGTAAAGGCAGGTATTCGGAGGTCTACGAAGTATTCAGCTACAGAAGAAACAGAAAAGATGATTC
AAATTGGTGATCTAACAATTGATCCAATTAATTTTACGGTTGAAAAAAACGGGAAGTCGCTCAAACTTACTTTAAAAGAA
TTTGAGATTTTAAAGCTATTCGTAAAGAATCAAAATCGTGTATTTACGAAAGCACAAATATACACGTTAGTTTGGAACGA
AGAGTATTACGGTGATGATAACGTTATTAATGTTCATATGAGAAGATTGCGTGAGAAAATCGAAAGCGATCCATCTAATC
CAGAATACATTAAAACGTTATGGGGCATCGGTTATAAGTTGGAAGTGATGTAA

Protein sequence :
MSHHILLVEDDISIQEMVEKYLIKEGFQVTIASDGEEGVNTYLKGSFDLIILDIMMPKLDGLEVVRIIREKSAVPILMMS
AKDTDVDKAVGLGLGADDYICKPFSMIELAARVKAGIRRSTKYSATEETEKMIQIGDLTIDPINFTVEKNGKSLKLTLKE
FEILKLFVKNQNRVFTKAQIYTLVWNEEYYGDDNVINVHMRRLREKIESDPSNPEYIKTLWGIGYKLEVM

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 9e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
YBT020_22300 YP_005568106.1 two-component response regulator ycbL AF155139.2.orf0.gene Protein 1e-45 47
YBT020_22300 YP_005568106.1 two-component response regulator ycbL NC_012469.1.7685629. Protein 3e-45 46
YBT020_22300 YP_005568106.1 two-component response regulator ycbL NC_002952.2859905.p0 Protein 2e-43 45
YBT020_22300 YP_005568106.1 two-component response regulator ycbL NC_009641.5332272.p0 Protein 3e-43 45
YBT020_22300 YP_005568106.1 two-component response regulator ycbL NC_013450.8614421.p0 Protein 3e-43 45
YBT020_22300 YP_005568106.1 two-component response regulator ycbL NC_007793.3914279.p0 Protein 3e-43 45
YBT020_22300 YP_005568106.1 two-component response regulator ycbL NC_007622.3794472.p0 Protein 2e-43 45
YBT020_22300 YP_005568106.1 two-component response regulator ycbL NC_002745.1124361.p0 Protein 3e-43 45
YBT020_22300 YP_005568106.1 two-component response regulator ycbL NC_009782.5559369.p0 Protein 3e-43 45
YBT020_22300 YP_005568106.1 two-component response regulator ycbL NC_002951.3237708.p0 Protein 3e-43 45
YBT020_22300 YP_005568106.1 two-component response regulator ycbL NC_003923.1003749.p0 Protein 2e-43 45
YBT020_22300 YP_005568106.1 two-component response regulator ycbL NC_002758.1121668.p0 Protein 3e-43 45
YBT020_22300 YP_005568106.1 two-component response regulator ycbL HE999704.1.gene2815. Protein 8e-43 45
YBT020_22300 YP_005568106.1 two-component response regulator ycbL NC_014475.1.orf0.gen Protein 2e-43 44
YBT020_22300 YP_005568106.1 two-component response regulator ycbL NC_005054.2598277.p0 Protein 2e-43 44
YBT020_22300 YP_005568106.1 two-component response regulator ycbL FJ349556.1.orf0.gene Protein 1e-43 43
YBT020_22300 YP_005568106.1 two-component response regulator ycbL AE016830.1.gene1681. Protein 4e-40 42
YBT020_22300 YP_005568106.1 two-component response regulator ycbL AF310956.2.orf0.gene Protein 4e-36 41
YBT020_22300 YP_005568106.1 two-component response regulator ycbL BAC0308 Protein 4e-36 41