Gene Information

Name : yclJ (I33_0605)
Accession : YP_005555586.1
Strain : Bacillus subtilis RO-NN-1
Genome accession: NC_017195
Putative virulence/resistance : Virulence
Product : two-component response regulator YclJ
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 566749 - 567519 bp
Length : 771 bp
Strand : -
Note : -

DNA sequence :
ATGAGTGATATTGCAGGCTCTAAGATAGATATATTCAATTTAATCATGAAACAGGGAATGAATGAAATAATGGATAAAAC
GAAAATACTTATTATTGAAGATGATGAAGCAATAGCAGATCTGCTTTCATACGGGCTTACGCAGGAAGGTTTTCAAACGT
GTACTGAATCTAACGGAGCTTTAGGGATGAAACAGCTAGACCAATTCAAACCCGATCTTCTGCTGCTTGATTGGATGCTG
CCAGATTGCAGCGGATTGGATATCTGTAAAAAAGTGACCCAACGCTATAATATCCCTATCCTTATGATCACCGCAAAGTC
AGATATCACTGATAAAGTCCTTGGGTTGGAATTTGGGGCTGACGATTATATTACAAAGCCATTTGACTTGCGTGAAGTTA
TCGCCAGAATTCGTACAATACTCAGGCGTCTTGAACAAGCTAATCACGTGAATGATCGAGGAACGTTTAATGAGGATCAC
ATTCAATTAAAACATATTGTGATAATCCCAGACGAAAGAATAGTAAAAAAAGATGGTATCATTGTTGATTTGACTCCTAA
AGAATTTGATCTGCTTAAGACATTGATTGACCATCGCGGAAAAATCTTTACACGTTCAGAGCTGTTGGAATTCGTTTGGG
GCTACGATTTTGCTGGGGATACACGTACGGTAGATACTCATATCCAAAGACTCCGTAAAAAACTGGATGCAAGCGACCTC
ATTAAAACAGTGTTTGGCATTGGATATAAATTCGAGAAGCAGGAGGAGTAG

Protein sequence :
MSDIAGSKIDIFNLIMKQGMNEIMDKTKILIIEDDEAIADLLSYGLTQEGFQTCTESNGALGMKQLDQFKPDLLLLDWML
PDCSGLDICKKVTQRYNIPILMITAKSDITDKVLGLEFGADDYITKPFDLREVIARIRTILRRLEQANHVNDRGTFNEDH
IQLKHIVIIPDERIVKKDGIIVDLTPKEFDLLKTLIDHRGKIFTRSELLEFVWGYDFAGDTRTVDTHIQRLRKKLDASDL
IKTVFGIGYKFEKQEE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 9e-29 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yclJ YP_005555586.1 two-component response regulator YclJ NC_002952.2859905.p0 Protein 4e-37 46
yclJ YP_005555586.1 two-component response regulator YclJ NC_007622.3794472.p0 Protein 5e-37 46
yclJ YP_005555586.1 two-component response regulator YclJ NC_002745.1124361.p0 Protein 6e-37 46
yclJ YP_005555586.1 two-component response regulator YclJ NC_009782.5559369.p0 Protein 6e-37 46
yclJ YP_005555586.1 two-component response regulator YclJ NC_002951.3237708.p0 Protein 6e-37 46
yclJ YP_005555586.1 two-component response regulator YclJ NC_003923.1003749.p0 Protein 5e-37 46
yclJ YP_005555586.1 two-component response regulator YclJ NC_002758.1121668.p0 Protein 6e-37 46
yclJ YP_005555586.1 two-component response regulator YclJ NC_009641.5332272.p0 Protein 6e-37 46
yclJ YP_005555586.1 two-component response regulator YclJ NC_013450.8614421.p0 Protein 6e-37 46
yclJ YP_005555586.1 two-component response regulator YclJ NC_007793.3914279.p0 Protein 6e-37 46
yclJ YP_005555586.1 two-component response regulator YclJ HE999704.1.gene2815. Protein 4e-34 45
yclJ YP_005555586.1 two-component response regulator YclJ NC_010079.5776364.p0 Protein 4e-28 43
yclJ YP_005555586.1 two-component response regulator YclJ NC_002952.2859858.p0 Protein 4e-28 43
yclJ YP_005555586.1 two-component response regulator YclJ NC_007622.3794948.p0 Protein 4e-28 43
yclJ YP_005555586.1 two-component response regulator YclJ NC_003923.1003417.p0 Protein 4e-28 43
yclJ YP_005555586.1 two-component response regulator YclJ NC_013450.8614146.p0 Protein 4e-28 43
yclJ YP_005555586.1 two-component response regulator YclJ NC_002951.3238224.p0 Protein 4e-28 43
yclJ YP_005555586.1 two-component response regulator YclJ NC_007793.3914065.p0 Protein 4e-28 43
yclJ YP_005555586.1 two-component response regulator YclJ NC_002758.1121390.p0 Protein 4e-28 43
yclJ YP_005555586.1 two-component response regulator YclJ NC_012469.1.7685629. Protein 5e-33 42
yclJ YP_005555586.1 two-component response regulator YclJ AE015929.1.gene1106. Protein 2e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yclJ YP_005555586.1 two-component response regulator YclJ VFG1702 Protein 4e-29 41
yclJ YP_005555586.1 two-component response regulator YclJ VFG1563 Protein 2e-28 41