Gene Information

Name : yceD (I33_0331)
Accession : YP_005555325.1
Strain : Bacillus subtilis RO-NN-1
Genome accession: NC_017195
Putative virulence/resistance : Resistance
Product : tellurium resistance protein TerD
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 299264 - 299845 bp
Length : 582 bp
Strand : +
Note : -

DNA sequence :
ATGACAATTTCATTGGCAAAAGGACAAAAAGTAGATTTAACCAAAACAAATCCGGGTCTTTCAAAGGTTGTTGTCGGTTT
AGGCTGGGATACGAACAAGTATGACGGCGGGCACGACTTTGATCTTGACTCAAGTGTGTTTCTGTTAGACGCTGCAGGCA
AATGCGCATCTCCAAACGACTTTATTTTCTACAACCAGCTTGAAGGCGGCAACGGTTCAGTCGTTCATTCAGGCGACAAC
CTGACTGGTGCTGGCGAAGGCGACGATGAGAATGTAAAAGTAAATCTCAGCGCTGTACCGGCAAACATTGATAAAATCTC
ATTTGTTATTACCATTCACGAAGCAGAAGCGCGCAGCCAAAACTTTGGACAAGTATCAAACGCGTTCGTCCGCATCGTAA
ATGAAGAAACAAATGAAGAGCTCATCCGTTACGATCTTGCAGAAGATTTCTCTATTGAAACGGCAATCATTGCAGGGGAG
CTTTACAGACATAACGGCGAGTGGAAATTCTCCGCAATCGGCTCAGGCTACCAAGGCGGCCTTGCCCGCATTGCAACAGA
CTACGGTTTGCAAGTCGGTTAA

Protein sequence :
MTISLAKGQKVDLTKTNPGLSKVVVGLGWDTNKYDGGHDFDLDSSVFLLDAAGKCASPNDFIFYNQLEGGNGSVVHSGDN
LTGAGEGDDENVKVNLSAVPANIDKISFVITIHEAEARSQNFGQVSNAFVRIVNEETNEELIRYDLAEDFSIETAIIAGE
LYRHNGEWKFSAIGSGYQGGLARIATDYGLQVG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-50 58
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-49 57
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-49 57
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-49 57
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 8e-41 51
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 7e-41 51
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-40 51
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-40 51
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-24 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yceD YP_005555325.1 tellurium resistance protein TerD BAC0389 Protein 1e-49 58
yceD YP_005555325.1 tellurium resistance protein TerD BAC0390 Protein 2e-44 53
yceD YP_005555325.1 tellurium resistance protein TerD BAC0392 Protein 5e-25 41