Gene Information

Name : yclJ (LL3_00354)
Accession : YP_005544131.1
Strain : Bacillus amyloliquefaciens LL3
Genome accession: NC_017190
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 367379 - 368062 bp
Length : 684 bp
Strand : +
Note : -

DNA sequence :
ATGAAGATATTAATGATAGAAGACAATATAAGCGTATGCACCATGACGGAAATGTTCTTTTTTAAAGAAGGATTTGAAGC
CGAATTTGTCCATGACGGAGTGGAAGGCTATCAGCGGTTTACGGAGGAGGACTGGGATTTGGTCATTCTGGACATTATGC
TTCCATCCATGGACGGAGTGACGATCTGCCGGAAAATAAGAGAGACGAGCAGTGTGCCGATTATTATGCTGACCGCAAAG
GACACTGAGTCCGATCAGGTAATCGGGTTTGAAATGGGGGCCGACGATTATGTCACTAAGCCGTTCAGCCCGCTGACGCT
TGTGGCGCGGATTAAAGCGGTGATCAGAAGATACCGGGCGACGGGGCAGGCCGTAAAAAGCGACGACTTGATCGAAACGG
CATGCTTTTCAATTAATAAGAAGACGCGGGAAGTGTTTCTTCACGGAAAATCCGTCGAGAATCTGACGCCGAAGGAATTT
GATCTGCTCTTTTATCTCGTACAGAACCCACGCCAGGTCTTCTCAAGAGAACAGCTGCTTGAGCAGGTGTGGGGCTATCA
ATTTTACGGTGATGAACGTACTGTTGATGTTCATATTAAACGGCTGCGTAAAAAACTGTCCAGTGACGAAAAACCGTTTT
TGTACACTGTGTGGGGGGTAGGATACAAATTTGATGAGGATTAA

Protein sequence :
MKILMIEDNISVCTMTEMFFFKEGFEAEFVHDGVEGYQRFTEEDWDLVILDIMLPSMDGVTICRKIRETSSVPIIMLTAK
DTESDQVIGFEMGADDYVTKPFSPLTLVARIKAVIRRYRATGQAVKSDDLIETACFSINKKTREVFLHGKSVENLTPKEF
DLLFYLVQNPRQVFSREQLLEQVWGYQFYGDERTVDVHIKRLRKKLSSDEKPFLYTVWGVGYKFDED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-41 46
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-40 45
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 3e-24 41
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 3e-24 41
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 3e-24 41
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 3e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yclJ YP_005544131.1 two-component response regulator NC_012469.1.7685629. Protein 2e-41 44
yclJ YP_005544131.1 two-component response regulator NC_002952.2859905.p0 Protein 1e-43 44
yclJ YP_005544131.1 two-component response regulator NC_002951.3237708.p0 Protein 2e-43 44
yclJ YP_005544131.1 two-component response regulator NC_003923.1003749.p0 Protein 2e-43 44
yclJ YP_005544131.1 two-component response regulator NC_002758.1121668.p0 Protein 2e-43 44
yclJ YP_005544131.1 two-component response regulator NC_009641.5332272.p0 Protein 2e-43 44
yclJ YP_005544131.1 two-component response regulator NC_013450.8614421.p0 Protein 2e-43 44
yclJ YP_005544131.1 two-component response regulator NC_007793.3914279.p0 Protein 2e-43 44
yclJ YP_005544131.1 two-component response regulator NC_007622.3794472.p0 Protein 1e-43 44
yclJ YP_005544131.1 two-component response regulator NC_002745.1124361.p0 Protein 2e-43 44
yclJ YP_005544131.1 two-component response regulator NC_009782.5559369.p0 Protein 2e-43 44
yclJ YP_005544131.1 two-component response regulator AF155139.2.orf0.gene Protein 1e-42 43
yclJ YP_005544131.1 two-component response regulator HE999704.1.gene2815. Protein 1e-44 43
yclJ YP_005544131.1 two-component response regulator DQ212986.1.gene4.p01 Protein 1e-38 42
yclJ YP_005544131.1 two-component response regulator AE016830.1.gene1681. Protein 4e-41 42
yclJ YP_005544131.1 two-component response regulator NC_010079.5776364.p0 Protein 2e-34 41
yclJ YP_005544131.1 two-component response regulator NC_002952.2859858.p0 Protein 2e-34 41
yclJ YP_005544131.1 two-component response regulator NC_007622.3794948.p0 Protein 2e-34 41
yclJ YP_005544131.1 two-component response regulator NC_003923.1003417.p0 Protein 2e-34 41
yclJ YP_005544131.1 two-component response regulator NC_013450.8614146.p0 Protein 2e-34 41
yclJ YP_005544131.1 two-component response regulator NC_002951.3238224.p0 Protein 2e-34 41
yclJ YP_005544131.1 two-component response regulator NC_007793.3914065.p0 Protein 2e-34 41
yclJ YP_005544131.1 two-component response regulator NC_002758.1121390.p0 Protein 2e-34 41
yclJ YP_005544131.1 two-component response regulator NC_010400.5986590.p0 Protein 3e-38 41
yclJ YP_005544131.1 two-component response regulator NC_011595.7057856.p0 Protein 6e-39 41
yclJ YP_005544131.1 two-component response regulator NC_010410.6002989.p0 Protein 6e-39 41
yclJ YP_005544131.1 two-component response regulator FJ349556.1.orf0.gene Protein 3e-41 41
yclJ YP_005544131.1 two-component response regulator NC_014475.1.orf0.gen Protein 7e-40 41
yclJ YP_005544131.1 two-component response regulator AM180355.1.gene1830. Protein 6e-36 41
yclJ YP_005544131.1 two-component response regulator NC_005054.2598277.p0 Protein 7e-40 41
yclJ YP_005544131.1 two-component response regulator AE000516.2.gene3505. Protein 7e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yclJ YP_005544131.1 two-component response regulator VFG1563 Protein 2e-41 46
yclJ YP_005544131.1 two-component response regulator VFG1702 Protein 6e-41 45
yclJ YP_005544131.1 two-component response regulator VFG1389 Protein 2e-31 42