Gene Information

Name : yceE (LL3_00276)
Accession : YP_005544057.1
Strain : Bacillus amyloliquefaciens LL3
Genome accession: NC_017190
Putative virulence/resistance : Resistance
Product : general stress protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 268809 - 269387 bp
Length : 579 bp
Strand : +
Note : -

DNA sequence :
ATGGCTATTCAATTGTCGAAAGGACAGCGTGTTGATCTGACAAAAACGAACCCAGGCCTTACAAAAGCGGTGATCGGCTT
AGGCTGGGATACGAACAAGTACTCCGGAGGGCATGATTTTGACCTTGATGCGTCGGCTTTTCTGGTCGATGCCCATGACA
ACTGTGTAAATGATCTTGATTTTGTTTTTTACAATAACCTGGAACATCCGAGCGGCGGCGTCATCCATACGGGAGACAAC
CGGACGGGTGAGGGCGATGGAGACGATGAACAAATTATCGTCGACTTCACAAAAATACCCGCAAATATAGAAAAGATCGG
CATCACCGTCACGATTCATGACGCGGAAGCGCGCGGCCAAAATTTCGGACAAGTCTCGAACGCGTTCGTGCGCGTCGTCG
ATGAAAACAACCAGAATGAACTGCTTCGTTTTGATTTAGGGGAAGACTTCTCGATTGAAACGGCGGTTGTCGTTTGTGAG
CTTTACCGCCATGGGGCTGAGTGGAAATTTAACGCCATCGGCAGCGGGTTTTCCGGCGGTCTGGCATCACTGTGCCGGAA
TTACGGCTTGCAGGTGTAA

Protein sequence :
MAIQLSKGQRVDLTKTNPGLTKAVIGLGWDTNKYSGGHDFDLDASAFLVDAHDNCVNDLDFVFYNNLEHPSGGVIHTGDN
RTGEGDGDDEQIIVDFTKIPANIEKIGITVTIHDAEARGQNFGQVSNAFVRVVDENNQNELLRFDLGEDFSIETAVVVCE
LYRHGAEWKFNAIGSGFSGGLASLCRNYGLQV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-53 57
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-47 55
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-47 55
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-47 55
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-51 54
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-51 54
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 4e-51 54
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-45 50
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 1e-27 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yceE YP_005544057.1 general stress protein BAC0390 Protein 1e-51 56
yceE YP_005544057.1 general stress protein BAC0389 Protein 1e-51 55