Gene Information

Name : RAM_16065 (RAM_16065)
Accession : YP_005531158.1
Strain : Amycolatopsis mediterranei S699
Genome accession: NC_017186
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3410143 - 3410835 bp
Length : 693 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence : 
ATGACGTCCCGGCTGCTGGTGGTGGACGACGAAGCCACCGTCCGCGAGCTGCTCTCCGCCGCGCTGCGGTTCGCCGGCTT
CCGGGTGACGTCGGCGGCCACCGCGCGGGAGGCCGTCGCCGCGGCCACCGCGGAGCCGCCCGACCTGGTGCTGCTGGACG
TCATGCTGCCGGACATGGACGGCTTCGAGGTGGTCCGGCGGCTGCGCGAGCGGCACCCCGGCCACGGCGCGCCGGTGCCC
GTCCTGTTCCTGACCGCGCGGGACCGCCAGTCCGACAAGGTCACCGGCCTGTCCCTCGGCGCCGACGACTACGTGACGAA
GCCCTTCGACCTGGCGGAGCTGATCGCGCGGATCCGCGCGATCCTCCGCCGGACCGCGGGCCGGCCGGCGGGCGTGCTCA
CGGCAGGCCCGCTCGCGCTCGACGCCGAGGGCCACCAGGTGACGCGTGCGGGGCAGGCGATCCGCTTGTCCGCCACGGAG
TTCCGGTTGCTGCGCTACCTGATGGAGAACGCCGGGCGGGTGGTGTCGAAGGGGCAGATCCTCGACCGGGTGTGGCGCGA
CGACTTCGGCGGGGACGCCGGCATCGTCGACACCTACATCTCCTACCTCCGGCGCAAGGTCGACACCGCGGAGCCGAAGC
TCATCCACACCGTGCACGGCGTGGGCTACGTGCTGCGGGAGCCCCGCGGATGA

Protein sequence : 
MTSRLLVVDDEATVRELLSAALRFAGFRVTSAATAREAVAAATAEPPDLVLLDVMLPDMDGFEVVRRLRERHPGHGAPVP
VLFLTARDRQSDKVTGLSLGADDYVTKPFDLAELIARIRAILRRTAGRPAGVLTAGPLALDAEGHQVTRAGQAIRLSATE
FRLLRYLMENAGRVVSKGQILDRVWRDDFGGDAGIVDTYISYLRRKVDTAEPKLIHTVHGVGYVLREPRG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-18 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RAM_16065 YP_005531158.1 two-component system response regulator BAC0197 Protein 1e-27 50
RAM_16065 YP_005531158.1 two-component system response regulator BAC0083 Protein 2e-24 47
RAM_16065 YP_005531158.1 two-component system response regulator BAC0308 Protein 2e-24 46
RAM_16065 YP_005531158.1 two-component system response regulator BAC0638 Protein 5e-18 44
RAM_16065 YP_005531158.1 two-component system response regulator BAC0125 Protein 6e-23 43
RAM_16065 YP_005531158.1 two-component system response regulator HE999704.1.gene2815. Protein 7e-22 42
RAM_16065 YP_005531158.1 two-component system response regulator NC_002951.3238224.p0 Protein 1e-21 42
RAM_16065 YP_005531158.1 two-component system response regulator NC_007793.3914065.p0 Protein 1e-21 42
RAM_16065 YP_005531158.1 two-component system response regulator NC_002758.1121390.p0 Protein 1e-21 42
RAM_16065 YP_005531158.1 two-component system response regulator NC_010079.5776364.p0 Protein 1e-21 42
RAM_16065 YP_005531158.1 two-component system response regulator NC_002952.2859858.p0 Protein 1e-21 42
RAM_16065 YP_005531158.1 two-component system response regulator AE015929.1.gene1106. Protein 2e-18 42
RAM_16065 YP_005531158.1 two-component system response regulator NC_007622.3794948.p0 Protein 1e-21 42
RAM_16065 YP_005531158.1 two-component system response regulator NC_003923.1003417.p0 Protein 1e-21 42
RAM_16065 YP_005531158.1 two-component system response regulator NC_013450.8614146.p0 Protein 1e-21 42
RAM_16065 YP_005531158.1 two-component system response regulator NC_002516.2.879194.p Protein 5e-20 42
RAM_16065 YP_005531158.1 two-component system response regulator NC_007622.3794472.p0 Protein 6e-23 41
RAM_16065 YP_005531158.1 two-component system response regulator AE000516.2.gene3505. Protein 1e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RAM_16065 YP_005531158.1 two-component system response regulator VFG1386 Protein 4e-43 54
RAM_16065 YP_005531158.1 two-component system response regulator VFG1390 Protein 7e-30 47
RAM_16065 YP_005531158.1 two-component system response regulator VFG0596 Protein 8e-19 44