Gene Information

Name : ABZJ_02689 (ABZJ_02689)
Accession : YP_005526645.1
Strain : Acinetobacter baumannii MDR-ZJ06
Genome accession: NC_017171
Putative virulence/resistance : Resistance
Product : putative multidrug resistance efflux protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2737825 - 2738154 bp
Length : 330 bp
Strand : +
Note : -

DNA sequence :
ATGTCTTATCTTTATTTAGCAATTGCGATTGCTTGTGAAGTTATTGCAACTTCAGCATTAAAAGCATCTCAAGGTTTTAC
TGTTCCAATTCCGTCTATTATTACGGTTGTGGGTTATGCAGTTGCTTTTTATTTATTATCTCTTACGCTCAAAACAATTC
CGATCGGGATTGCCTATGCCATTTGGTCAGGCGCAGGTATTATTTTAATTTCTGCAATTGGCTGGATATTTTACAAACAG
CATTTAGACTTGGCTGCCTGTACTGGTTTGGCTTTAATGATCGCAGGTATTGTGATTATTAATGTGTTTTCTAAAAACAC
CCATCTATAA

Protein sequence :
MSYLYLAIAIACEVIATSALKASQGFTVPIPSIITVVGYAVAFYLLSLTLKTIPIGIAYAIWSGAGIILISAIGWIFYKQ
HLDLAACTGLALMIAGIVIINVFSKNTHL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 6e-14 54
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 6e-14 54
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 6e-14 54
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 9e-14 54
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 6e-14 54
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 6e-14 54
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 6e-14 54
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 9e-14 54
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 6e-14 54
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 6e-14 54
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 6e-14 54
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 6e-14 54
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 6e-14 54
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 6e-14 54
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 6e-14 54
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 6e-14 54
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 6e-14 54
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 6e-14 54
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 6e-14 54
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 6e-14 54
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 6e-14 54
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 9e-14 54
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 6e-14 54
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 6e-14 54
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 6e-14 54
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 9e-14 54
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 6e-14 54
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 6e-14 54
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 6e-14 54
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 9e-14 54
unnamed CAD42068.1 hypothetical protein Not tested PAI II 536 Protein 2e-07 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ABZJ_02689 YP_005526645.1 putative multidrug resistance efflux protein BAC0002 Protein 3e-35 99
ABZJ_02689 YP_005526645.1 putative multidrug resistance efflux protein NC_010410.6003348.p0 Protein 3e-35 99
ABZJ_02689 YP_005526645.1 putative multidrug resistance efflux protein BAC0324 Protein 3e-17 54
ABZJ_02689 YP_005526645.1 putative multidrug resistance efflux protein CP004022.1.gene1549. Protein 8e-14 54
ABZJ_02689 YP_005526645.1 putative multidrug resistance efflux protein BAC0323 Protein 3e-14 54
ABZJ_02689 YP_005526645.1 putative multidrug resistance efflux protein BAC0150 Protein 3e-12 52
ABZJ_02689 YP_005526645.1 putative multidrug resistance efflux protein NC_002695.1.913273.p Protein 4e-12 51
ABZJ_02689 YP_005526645.1 putative multidrug resistance efflux protein BAC0322 Protein 4e-17 51
ABZJ_02689 YP_005526645.1 putative multidrug resistance efflux protein BAC0377 Protein 8e-17 51
ABZJ_02689 YP_005526645.1 putative multidrug resistance efflux protein CP001138.1.gene1489. Protein 8e-13 51
ABZJ_02689 YP_005526645.1 putative multidrug resistance efflux protein BAC0325 Protein 4e-10 43
ABZJ_02689 YP_005526645.1 putative multidrug resistance efflux protein BAC0139 Protein 3e-13 43
ABZJ_02689 YP_005526645.1 putative multidrug resistance efflux protein BAC0140 Protein 1e-08 43
ABZJ_02689 YP_005526645.1 putative multidrug resistance efflux protein BAC0192 Protein 2e-12 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ABZJ_02689 YP_005526645.1 putative multidrug resistance efflux protein VFG1587 Protein 1e-07 44