Gene Information

Name : ABZJ_01289 (ABZJ_01289)
Accession : YP_005525245.1
Strain : Acinetobacter baumannii MDR-ZJ06
Genome accession: NC_017171
Putative virulence/resistance : Resistance
Product : streptomycin/spectinomycin adenyltransferase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1344723 - 1345514 bp
Length : 792 bp
Strand : +
Note : -

DNA sequence :
ATGAGGGAAGCGGTGATCGCCGAAGTATCGACTCAACTATCAGAGGTAGTTGGCGTCATCGAGCGCCATCTCGAACCGAC
GTTGCTGGCCGTACATTTGTACGGCTCCGCAGTGGATGGCGGCCTGAAGCCACACAGTGATATTGATTTGCTGGTTACGG
TGACCGTAAGGCTTGATGAAACAACGCGGCGAGCTTTGATCAACGACCTTTTGGAAACTTCGGCTTCCCCTGGAGAGAGC
GAGATTCTCCGCGCTGTAGAAGTCACCATTGTTGTGCACGACGACATCATTCCGTGGCGTTATCCAGCTAAGCGCGAACT
GCAATTTGGAGAATGGCAGCGCAATGACATTCTTGCAGGTATCTTCGAGCCAGCCACGATCGACATTGATCTGGCTATCT
TGCTGACAAAAGCAAGAGAACATAGCGTTGCCTTGGTAGGTCCAGCGGCGGAGGAACTCTTTGATCCGGTTCCTGAACAG
GATCTATTTGAGGCGCTAAATGAAACCTTAACGCTATGGAACTCGCCGCCCGACTGGGCTGGCGATGAGCGAAATGTAGT
GCTTACGTTGTCCCGCATTTGGTACAGCGCAGTAACCGGCAAAATCGCGCCGAAGGATGTCGCTGCCGACTGGGCAATGG
AGCGCCTGCCGGCCCAGTATCAGCCCGTCATACTTGAAGCTAGACAGGCTTATCTTGGACAAGAAGAAGATCGCTTGGCC
TCGCGCGCAGATCAGTTGGAAGAATTTGTCCACTACGTGAAAGGCGAGATCACCAAGGTAGTCGGCAAATAA

Protein sequence :
MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPHSDIDLLVTVTVRLDETTRRALINDLLETSASPGES
EILRAVEVTIVVHDDIIPWRYPAKRELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQ
DLFEALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQPVILEARQAYLGQEEDRLA
SRADQLEEFVHYVKGEITKVVGK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aadA1 YP_005797133.1 aminoglycoside 3'-adenyltransferase Not tested AbaR4e Protein 3e-118 100
aadA1 YP_005797149.1 aminoglycoside 3'-adenyltransferase Not tested AbaR4e Protein 3e-118 100
aadDA1 CAJ77087.1 Aminoglycoside 3-adenylyltransferase Not tested AbaR1 Protein 2e-118 100
aadA1 YP_006098376.1 aminoglycoside adenylyltransferase Not tested Tn2411 Protein 3e-118 100
aadA1 ACV89835.1 AadA1 aminoglycoside (3')(9) adenylyltransferase Not tested AbaR7 Protein 2e-118 100
aadA1 ACN81025.1 AadA1 aminoglycoside (3')(9) adenylyltransferase Not tested AbaR5 Protein 3e-118 100
unnamed AFV53113.1 AadA1 aminoglycoside (3') adenyltransferase Not tested AbGRI2-1 Protein 2e-118 100
aadA1 AGK36646.1 AadA1 aminoglycoside (3')(9) adenylyltransferase Not tested AbaR26 Protein 2e-118 100
aadA1 ACY75515.1 aminoglycoside adenyltransferase Not tested Tn6060 Protein 3e-118 99
aadA1 CAD92142.1 aminoglycoside adenyltransferase Not tested Not named Protein 3e-118 99
aadA1 CAJ77048.1 Aminoglycoside adenylyltransferase Not tested AbaR1 Protein 9e-119 99
aadA1 AAL08435.1 streptomycin adenyltransferase AadA1 Not tested SRL Protein 4e-112 96
aadA25 YP_005176241.1 aminoglycoside 3''-O-adenyltransferase protein Not tested ICEPmu1 Protein 5e-111 92
aadA2 AAK02046.1 streptomycin/spectinomycin resistance protein Not tested SGI1 Protein 9e-106 87
aadA2 AGF35027.1 AadA2 aminoglycoside adenylyltransferase Not tested SGI1 Protein 9e-106 87
aadA2 ACF06158.1 aminoglycoside 3''-adenyltransferase Not tested Tn5036-like Protein 2e-106 87
aadA7 AGK06932.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 3e-91 72
aadA7 AGK06969.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 3e-91 72
aadA7 AGK07015.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 3e-91 72
aadA7 AGK07073.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 3e-91 72
aadA7 AAR21854.1 aminoglycoside (3'')(9) adenylyltransferase; AAD(3'')(9) Not tested SGI1 Protein 3e-91 72
aadA7 AAT37846.1 aminoglycoside adenyltransferase Not tested Class I integron Protein 3e-91 72
aadA7 AGF35062.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 3e-91 72

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ABZJ_01289 YP_005525245.1 streptomycin/spectinomycin adenyltransferase AY123251.gene3.p01 Protein 1e-118 100
ABZJ_01289 YP_005525245.1 streptomycin/spectinomycin adenyltransferase NC_010410.6003168.p0 Protein 1e-118 100
ABZJ_01289 YP_005525245.1 streptomycin/spectinomycin adenyltransferase AF313471.1.gene3.p01 Protein 1e-118 100
ABZJ_01289 YP_005525245.1 streptomycin/spectinomycin adenyltransferase AY339625.2.gene17.p0 Protein 1e-118 100
ABZJ_01289 YP_005525245.1 streptomycin/spectinomycin adenyltransferase AJ584652.2.gene7.p01 Protein 5e-117 99
ABZJ_01289 YP_005525245.1 streptomycin/spectinomycin adenyltransferase FR748153.1.gene5.p01 Protein 2e-118 99
ABZJ_01289 YP_005525245.1 streptomycin/spectinomycin adenyltransferase Y18050.2.gene6.p01 Protein 2e-118 99
ABZJ_01289 YP_005525245.1 streptomycin/spectinomycin adenyltransferase AJ704863.gene12.p01 Protein 9e-107 99
ABZJ_01289 YP_005525245.1 streptomycin/spectinomycin adenyltransferase AM932669.1.gene3.p01 Protein 2e-116 99
ABZJ_01289 YP_005525245.1 streptomycin/spectinomycin adenyltransferase JN596991.2.gene3.p01 Protein 2e-118 99
ABZJ_01289 YP_005525245.1 streptomycin/spectinomycin adenyltransferase AJ628353.gene.p01 Protein 8e-89 99
ABZJ_01289 YP_005525245.1 streptomycin/spectinomycin adenyltransferase NC_010410.6003170.p0 Protein 6e-119 99
ABZJ_01289 YP_005525245.1 streptomycin/spectinomycin adenyltransferase AF047479.2.orf1.gene Protein 1e-107 88
ABZJ_01289 YP_005525245.1 streptomycin/spectinomycin adenyltransferase EU118119.1.orf1.gene Protein 6e-106 87
ABZJ_01289 YP_005525245.1 streptomycin/spectinomycin adenyltransferase AF294653.1.gene3.p01 Protein 2e-104 87
ABZJ_01289 YP_005525245.1 streptomycin/spectinomycin adenyltransferase AY263741.gene.p01 Protein 6e-104 86
ABZJ_01289 YP_005525245.1 streptomycin/spectinomycin adenyltransferase AF174129.3.gene3.p01 Protein 5e-104 86
ABZJ_01289 YP_005525245.1 streptomycin/spectinomycin adenyltransferase U37105.2.gene4.p01 Protein 3e-95 76
ABZJ_01289 YP_005525245.1 streptomycin/spectinomycin adenyltransferase DQ865198.gene.p01 Protein 2e-73 58
ABZJ_01289 YP_005525245.1 streptomycin/spectinomycin adenyltransferase AY139598.1.gene2.p01 Protein 8e-73 58
ABZJ_01289 YP_005525245.1 streptomycin/spectinomycin adenyltransferase NC_010558.1.6275994. Protein 2e-73 58
ABZJ_01289 YP_005525245.1 streptomycin/spectinomycin adenyltransferase NC_003198.gene.p01 Protein 4e-50 45

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ABZJ_01289 YP_005525245.1 streptomycin/spectinomycin adenyltransferase VFG1026 Protein 2e-112 96