Gene Information

Name : TC41_0059 (TC41_0059)
Accession : YP_005516558.1
Strain : Alicyclobacillus acidocaldarius Tc-4-1
Genome accession: NC_017167
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 60839 - 61522 bp
Length : 684 bp
Strand : +
Note : -

DNA sequence :

GTGATGAACATGGCGACCATCCTTGTGGCCGACGACGAGCCTCACATCCGCGAACTCGTGCGCAGCACGCTCGAGCGGGA
AGGGCATCGGGTGGTGGAGGCGGCGGACGGGCGCGAGGCGGCGGATGCACTGGCCCGTGAGCCCGTGCAGCTCGCCGTGA
TCGACGTGATGATGCCCGAGGTGGACGGGTTCGAGCTGACGCAATGGTTGCGCGAAGAGCGCGATGTGCCGATTCTGCTC
CTGACCGCGCTCGGGGAGACAAGCCACAAGGTGCGCGGCCTTCGGCTCGGCGCGGACGACTACCTCGTCAAGCCCTTCGC
CCCCGAGGAGCTTGTGGCGCGCGTCGAGGCGCTTCTGCGCCGTTACCGCATGCGGGCGGACGGCGCGCTCGATCTCGCCG
GACTCCGCCTCCTCTCGGACACGTATGAAGTCGAGGCGAACGGGGAGCGCATGGCCCTTCCGCCGAAGGAGTTTCAGCTT
CTGTTCACGCTGGCCGCGTCGGCGGGCAAGACGCTCTCCCGCGACAAGCTGATTGAAGAGGTGTGGGGGTACGACTACGC
GGGGGACGAGCGGACGGTGGACGTGCACATTAAGCGGTTGCGCGACAAATTCCCCGAGGACATCTACCCGTTTCGCATCC
GCACCGTGCGCGGGTTGGGGTATCGCCTGGAGGTGAACGCGTGA

Protein sequence :

MMNMATILVADDEPHIRELVRSTLEREGHRVVEAADGREAADALAREPVQLAVIDVMMPEVDGFELTQWLREERDVPILL
LTALGETSHKVRGLRLGADDYLVKPFAPEELVARVEALLRRYRMRADGALDLAGLRLLSDTYEVEANGERMALPPKEFQL
LFTLAASAGKTLSRDKLIEEVWGYDYAGDERTVDVHIKRLRDKFPEDIYPFRIRTVRGLGYRLEVNA

• Homologs from PAI DB

Gene	GenBank Accn	Product	Virulance or Resistance	PAI or REI	Alignment Type	E-val	Identity
copR	NP_460069.2	transcriptional regulatory protein YedW	Not tested	SPI-5	Protein	2e-24	42

• Homologs from CARD and BacMet (resistance genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
TC41_0059	YP_005516558.1	winged helix family two component transcriptional regulator	HE999704.1.gene2815.	Protein	2e-34	44
TC41_0059	YP_005516558.1	winged helix family two component transcriptional regulator	BAC0347	Protein	1e-25	44
TC41_0059	YP_005516558.1	winged helix family two component transcriptional regulator	BAC0111	Protein	2e-28	44
TC41_0059	YP_005516558.1	winged helix family two component transcriptional regulator	NC_002952.2859905.p0	Protein	9e-33	43
TC41_0059	YP_005516558.1	winged helix family two component transcriptional regulator	NC_009641.5332272.p0	Protein	8e-33	43
TC41_0059	YP_005516558.1	winged helix family two component transcriptional regulator	NC_013450.8614421.p0	Protein	8e-33	43
TC41_0059	YP_005516558.1	winged helix family two component transcriptional regulator	NC_007793.3914279.p0	Protein	8e-33	43
TC41_0059	YP_005516558.1	winged helix family two component transcriptional regulator	NC_007622.3794472.p0	Protein	8e-33	43
TC41_0059	YP_005516558.1	winged helix family two component transcriptional regulator	NC_002745.1124361.p0	Protein	8e-33	43
TC41_0059	YP_005516558.1	winged helix family two component transcriptional regulator	NC_009782.5559369.p0	Protein	8e-33	43
TC41_0059	YP_005516558.1	winged helix family two component transcriptional regulator	NC_002951.3237708.p0	Protein	8e-33	43
TC41_0059	YP_005516558.1	winged helix family two component transcriptional regulator	NC_003923.1003749.p0	Protein	8e-33	43
TC41_0059	YP_005516558.1	winged helix family two component transcriptional regulator	NC_002758.1121668.p0	Protein	8e-33	43
TC41_0059	YP_005516558.1	winged helix family two component transcriptional regulator	NC_012469.1.7685629.	Protein	1e-31	41
TC41_0059	YP_005516558.1	winged helix family two component transcriptional regulator	AE000516.2.gene3505.	Protein	3e-24	41

• Homologs from VFDB (virulence genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
TC41_0059	YP_005516558.1	winged helix family two component transcriptional regulator	VFG1390	Protein	6e-25	43
TC41_0059	YP_005516558.1	winged helix family two component transcriptional regulator	VFG0596	Protein	7e-25	42
TC41_0059	YP_005516558.1	winged helix family two component transcriptional regulator	VFG1389	Protein	4e-22	42