Gene Information

Name : TC41_0059 (TC41_0059)
Accession : YP_005516558.1
Strain : Alicyclobacillus acidocaldarius Tc-4-1
Genome accession: NC_017167
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 60839 - 61522 bp
Length : 684 bp
Strand : +
Note : -

DNA sequence :
GTGATGAACATGGCGACCATCCTTGTGGCCGACGACGAGCCTCACATCCGCGAACTCGTGCGCAGCACGCTCGAGCGGGA
AGGGCATCGGGTGGTGGAGGCGGCGGACGGGCGCGAGGCGGCGGATGCACTGGCCCGTGAGCCCGTGCAGCTCGCCGTGA
TCGACGTGATGATGCCCGAGGTGGACGGGTTCGAGCTGACGCAATGGTTGCGCGAAGAGCGCGATGTGCCGATTCTGCTC
CTGACCGCGCTCGGGGAGACAAGCCACAAGGTGCGCGGCCTTCGGCTCGGCGCGGACGACTACCTCGTCAAGCCCTTCGC
CCCCGAGGAGCTTGTGGCGCGCGTCGAGGCGCTTCTGCGCCGTTACCGCATGCGGGCGGACGGCGCGCTCGATCTCGCCG
GACTCCGCCTCCTCTCGGACACGTATGAAGTCGAGGCGAACGGGGAGCGCATGGCCCTTCCGCCGAAGGAGTTTCAGCTT
CTGTTCACGCTGGCCGCGTCGGCGGGCAAGACGCTCTCCCGCGACAAGCTGATTGAAGAGGTGTGGGGGTACGACTACGC
GGGGGACGAGCGGACGGTGGACGTGCACATTAAGCGGTTGCGCGACAAATTCCCCGAGGACATCTACCCGTTTCGCATCC
GCACCGTGCGCGGGTTGGGGTATCGCCTGGAGGTGAACGCGTGA

Protein sequence :
MMNMATILVADDEPHIRELVRSTLEREGHRVVEAADGREAADALAREPVQLAVIDVMMPEVDGFELTQWLREERDVPILL
LTALGETSHKVRGLRLGADDYLVKPFAPEELVARVEALLRRYRMRADGALDLAGLRLLSDTYEVEANGERMALPPKEFQL
LFTLAASAGKTLSRDKLIEEVWGYDYAGDERTVDVHIKRLRDKFPEDIYPFRIRTVRGLGYRLEVNA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-24 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TC41_0059 YP_005516558.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-34 44
TC41_0059 YP_005516558.1 winged helix family two component transcriptional regulator BAC0347 Protein 1e-25 44
TC41_0059 YP_005516558.1 winged helix family two component transcriptional regulator BAC0111 Protein 2e-28 44
TC41_0059 YP_005516558.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 9e-33 43
TC41_0059 YP_005516558.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 8e-33 43
TC41_0059 YP_005516558.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 8e-33 43
TC41_0059 YP_005516558.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 8e-33 43
TC41_0059 YP_005516558.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 8e-33 43
TC41_0059 YP_005516558.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 8e-33 43
TC41_0059 YP_005516558.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 8e-33 43
TC41_0059 YP_005516558.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 8e-33 43
TC41_0059 YP_005516558.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 8e-33 43
TC41_0059 YP_005516558.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 8e-33 43
TC41_0059 YP_005516558.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 1e-31 41
TC41_0059 YP_005516558.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 3e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TC41_0059 YP_005516558.1 winged helix family two component transcriptional regulator VFG1390 Protein 6e-25 43
TC41_0059 YP_005516558.1 winged helix family two component transcriptional regulator VFG0596 Protein 7e-25 42
TC41_0059 YP_005516558.1 winged helix family two component transcriptional regulator VFG1389 Protein 4e-22 42