Gene Information

Name : TC41_0373 (TC41_0373)
Accession : YP_005516858.1
Strain : Alicyclobacillus acidocaldarius Tc-4-1
Genome accession: NC_017167
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 366858 - 367220 bp
Length : 363 bp
Strand : +
Note : -

DNA sequence :
TTGCTAGCCTTCGACTGGACTTCGGATCACCGCGTGTATCTCGCCTGTGGCGCCACAGACATGCGCAAATCCATTGACGG
ACTCGCCGCACTCGTTCAGGCGTCGTTTCAACTCGATCCGTTTTCGCCATGCCTGTTTGTCTTCTGCAATCGGCAACGGG
ACAAGCTCAAAATCTTGCACTGGTCGCACAACGGCTTTTGGCTGTACTATCGGCGCTTAGAGCGCGGTCGATTCGATTGG
CCAGAGACAGGAGATGCCAAGACCATGGTGATCACACGGCGAGAGCTGAACTGGCTCCTGGATGGCCTGCCGCTCGAGCA
GCCGAAAGCGCATCGAGCTGTGCATGTCCGTTCTGCGATTTAA

Protein sequence :
MLAFDWTSDHRVYLACGATDMRKSIDGLAALVQASFQLDPFSPCLFVFCNRQRDKLKILHWSHNGFWLYYRRLERGRFDW
PETGDAKTMVITRRELNWLLDGLPLEQPKAHRAVHVRSAI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAF71493.1 unknown Not tested Hrp PAI Protein 3e-17 47
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 8e-14 46
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 8e-14 46
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 2e-12 45
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 2e-12 45
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-13 45
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 5e-12 43
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 1e-13 42
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 1e-13 42
unnamed AAL08461.1 unknown Not tested SRL Protein 1e-11 42
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 3e-13 41
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 1e-11 41
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 1e-11 41
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 1e-11 41
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-11 41
unnamed AAL99258.1 unknown Not tested LEE Protein 1e-11 41
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 2e-11 41
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 1e-11 41
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 2e-11 41
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 2e-11 41
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-11 41
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-11 41
unnamed AAC31493.1 L0014 Not tested LEE Protein 1e-11 41
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 3e-11 41
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 3e-11 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TC41_0373 YP_005516858.1 IS66 Orf2 family protein VFG1737 Protein 3e-14 45
TC41_0373 YP_005516858.1 IS66 Orf2 family protein VFG1052 Protein 4e-12 42
TC41_0373 YP_005516858.1 IS66 Orf2 family protein VFG1665 Protein 1e-13 41
TC41_0373 YP_005516858.1 IS66 Orf2 family protein VFG1698 Protein 4e-12 41
TC41_0373 YP_005516858.1 IS66 Orf2 family protein VFG1709 Protein 5e-12 41
TC41_0373 YP_005516858.1 IS66 Orf2 family protein VFG0792 Protein 5e-12 41