Gene Information

Name : resD (TC41_1627)
Accession : YP_005518075.1
Strain : Alicyclobacillus acidocaldarius Tc-4-1
Genome accession: NC_017167
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1592968 - 1593669 bp
Length : 702 bp
Strand : -
Note : -

DNA sequence :
ATGGCACAGACGCGAATCTTGGTTGTGGACGACGAGGAACGGATTCGCCGATTGGTTCGCATGTACCTCGAGCGAAACGG
GTTTGAGGTCGATGAGGCGGCTGATGGAAAAGAAGCACTCAACAAGGCTTTGAATCAGGCGTACGCATTGATTATTTTAG
ACCTGATGTTGCCCGGGATGGACGGTCGTGACGTGTGCGCGCAAATTCGTCAGCACAGCAACGTGCCCATTATGATGCTG
ACCGCAGCGGGCGATGAGGCGAATCGCGTCCACGGCTTCGAACTGGGAGCCGACGACTATGTCGTCAAGCCGTTCAGCCC
GCGCGAACTCGTGCTGCGCGTGAAGGCCATGCTCAAGCGCACCGGTGAAGTGGAGTATGGCCGAAATGCGATTCAAACGC
TTACGTTTCCCGGCTTGGAGATTCAGATCGACGCGCGCCGCGTCGAGGTCAACGGTCAGGAGGTCAATCTGACCCCGAAG
GAGTTCGACCTTTTAGTCTACATGGCTCAGCGCCCTGATAAGGTCTTTAGCCGTGAAGAACTGCTGAGGGATGTTTGGAA
TTATCAGTTCTTCGGAGATCAGCGCACCGTAGACACACATATCAAACGGCTTCGCGAAAAGCTGGGCCAGGCTTCGCCCG
AGGTGAGCCGCTACATTGTGACCGTGTGGGGCGTCGGGTACAAGTTCGAGGTGGCTTCGTGA

Protein sequence :
MAQTRILVVDDEERIRRLVRMYLERNGFEVDEAADGKEALNKALNQAYALIILDLMLPGMDGRDVCAQIRQHSNVPIMML
TAAGDEANRVHGFELGADDYVVKPFSPRELVLRVKAMLKRTGEVEYGRNAIQTLTFPGLEIQIDARRVEVNGQEVNLTPK
EFDLLVYMAQRPDKVFSREELLRDVWNYQFFGDQRTVDTHIKRLREKLGQASPEVSRYIVTVWGVGYKFEVAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-39 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-38 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
resD YP_005518075.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-45 50
resD YP_005518075.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-45 50
resD YP_005518075.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-45 50
resD YP_005518075.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-45 50
resD YP_005518075.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-45 50
resD YP_005518075.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-45 50
resD YP_005518075.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-45 50
resD YP_005518075.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-45 50
resD YP_005518075.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-45 50
resD YP_005518075.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-45 50
resD YP_005518075.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 1e-46 46
resD YP_005518075.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 1e-42 45
resD YP_005518075.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-41 45
resD YP_005518075.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 7e-44 43
resD YP_005518075.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 4e-36 42
resD YP_005518075.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 1e-44 42
resD YP_005518075.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-39 41
resD YP_005518075.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-39 41
resD YP_005518075.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-39 41
resD YP_005518075.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-39 41
resD YP_005518075.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-39 41
resD YP_005518075.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-39 41
resD YP_005518075.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-39 41
resD YP_005518075.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-39 41
resD YP_005518075.1 winged helix family two component transcriptional regulator NC_010410.6002989.p0 Protein 2e-34 41
resD YP_005518075.1 winged helix family two component transcriptional regulator NC_011595.7057856.p0 Protein 2e-34 41
resD YP_005518075.1 winged helix family two component transcriptional regulator NC_010400.5986590.p0 Protein 2e-33 41
resD YP_005518075.1 winged helix family two component transcriptional regulator BAC0125 Protein 4e-35 41
resD YP_005518075.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-42 41
resD YP_005518075.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-34 41
resD YP_005518075.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 2e-39 41
resD YP_005518075.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 2e-42 41
resD YP_005518075.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 1e-33 41
resD YP_005518075.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 6e-34 41
resD YP_005518075.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 4e-34 41
resD YP_005518075.1 winged helix family two component transcriptional regulator BAC0596 Protein 1e-33 41
resD YP_005518075.1 winged helix family two component transcriptional regulator BAC0039 Protein 6e-34 41
resD YP_005518075.1 winged helix family two component transcriptional regulator AF162694.1.orf4.gene Protein 2e-36 41
resD YP_005518075.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 2e-34 41
resD YP_005518075.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 1e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
resD YP_005518075.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-33 44
resD YP_005518075.1 winged helix family two component transcriptional regulator VFG1563 Protein 2e-39 42
resD YP_005518075.1 winged helix family two component transcriptional regulator VFG1702 Protein 1e-38 41