Gene Information

Name : APA42C_43580 (APA42C_43580)
Accession : YP_005503086.1
Strain :
Genome accession: NC_017151
Putative virulence/resistance : Unknown
Product : transposase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3140 - 3463 bp
Length : 324 bp
Strand : -
Note : -

DNA sequence :
ATGAGCAACAAATCGAAGCGTTTTCCGCCTGAATTTCGTGAACGTGCAGCCCGCATGGTTCTGGAGGAAGAGAAGAACCA
TCCATCACGCTGGTCCGCGGTGATGATGATAGCGCCAAAGCTGGATATTCATCCTGACACGCTGTCAAAATGGACCCGTC
TGCATGAACGTGCCAATGCGCCTGCGGTGAGTGAGCTGCCTGATCGAGAGAAGATCAGGCAACTGGAGCGAGAGAACCGC
GAATTGCGGCAGGCCAATGACATCCTGCGTAAGGCGTCGGCATATTTTGCCCAGGCGGAGCTCGACCGCATCTTCAAGCC
ATGA

Protein sequence :
MSNKSKRFPPEFRERAARMVLEEEKNHPSRWSAVMMIAPKLDIHPDTLSKWTRLHERANAPAVSELPDREKIRQLERENR
ELRQANDILRKASAYFAQAELDRIFKP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1222 NP_286757.1 hypothetical protein Not tested TAI Protein 6e-17 52
Z1639 NP_287142.1 hypothetical protein Not tested TAI Protein 6e-17 52
Z1661 NP_287163.1 hypothetical protein Not tested TAI Protein 6e-17 52
ECO111_3720 YP_003236060.1 putative IS629 transposase OrfA Not tested LEE Protein 9e-16 52
IS629 CAC37925.1 hypothetical protein Not tested LEE Protein 5e-17 52
ECO111_3775 YP_003236110.1 putative IS629 transposase OrfA Not tested LEE Protein 9e-16 52
IS629 CAI43820.1 hypothetical protein Not tested LEE Protein 5e-17 52
Z4335 NP_289560.1 hypothetical protein Not tested OI-122 Protein 9e-16 52
IS629 CAI43841.1 hypothetical protein Not tested LEE Protein 5e-17 52
ECO103_3584 YP_003223442.1 IS629 transposase OrfA Not tested LEE Protein 7e-17 52
IS629 CAI43908.1 hypothetical protein 1 Not tested LEE Protein 5e-17 52
Z1199 NP_286734.1 hypothetical protein Not tested TAI Protein 6e-17 52
c5214 NP_757062.1 hypothetical protein Not tested PAI II CFT073 Protein 9e-15 50
tnpE AAD44738.1 TnpE Not tested SHI-2 Protein 8e-15 50
S3184 NP_838467.1 IS629 orfA Not tested SHI-1 Protein 9e-15 50
unnamed AAL67399.1 TnpE-like protein Not tested PAI II CFT073 Protein 6e-15 50
SF2979 NP_708753.1 IS629 ORF1 Not tested SHI-1 Protein 9e-15 50
c3596 NP_755471.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-12 50
unnamed ADD91740.1 hypothetical protein Not tested PAI-I AL862 Protein 6e-15 50
c5177 NP_757025.1 hypothetical protein Not tested PAI II CFT073 Protein 1e-12 50
r13 AAC61722.1 R13 Not tested PAI I CFT073 Protein 7e-13 50
ECUMN_3344 YP_002414020.1 transposase ORF A, IS629 Not tested Not named Protein 1e-12 50
unnamed AAL67404.1 R13-like protein Not tested PAI II CFT073 Protein 7e-13 50
S4062 NP_839231.1 IS629 orfA Not tested SHI-2 Protein 5e-13 50
SF3706 NP_709445.1 IS629 ORF1 Not tested SHI-2 Protein 1e-14 50
unnamed CAD42084.1 hypothetical protein Not tested PAI II 536 Protein 2e-13 50
c5168 NP_757016.1 hypothetical protein Not tested PAI II CFT073 Protein 9e-15 50
unnamed AAF09023.1 unknown Not tested SHI-O Protein 8e-15 50
APECO1_3498 YP_854313.1 transposase; OrfA protein of insertion sequence IS629 Not tested PAI I APEC-O1 Protein 2e-12 49
ORF_36 AAZ04445.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 2e-12 49

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
APA42C_43580 YP_005503086.1 transposase VFG1603 Protein 9e-14 50
APA42C_43580 YP_005503086.1 transposase VFG0643 Protein 3e-15 50
APA42C_43580 YP_005503086.1 transposase VFG1717 Protein 3e-13 50
APA42C_43580 YP_005503086.1 transposase VFG0606 Protein 3e-15 50