Gene Information

Name : BMWSH_2609 (BMWSH_2609)
Accession : YP_005494800.1
Strain : Bacillus megaterium WSH-002
Genome accession: NC_017138
Putative virulence/resistance : Resistance
Product : Response regulators consisting of a CheY-like receiver domain protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2462102 - 2462797 bp
Length : 696 bp
Strand : +
Note : -

DNA sequence :
ATGGTGATACACATGAAGAAGATATTGTTGATTGAAGATGAAGTAAGTATTGCTGAATTGCAAAGAGATTATTTAGAAAT
TAACGATTTTGAAATAGACGTTCAATATAGTGGTGATAAGGGATTAGAAAAAGCGTTAAATGAACATTTTGATTTGGTTA
TTTTGGATATTATGCTCCCTAAAGTGAGTGGATTTGAAGTGTGCAAGCAAATTCGAGCTGCAAAAGATATTCCAATCATT
TTAGTTTCAGCTAAAAAAGAAGAAATCGATAAAATTAGAGGGCTCGGGCTAGGTGCAGATGACTATATTACCAAGCCATT
CAGCCCTGGGGAGCTGGTCGCAAGAGTCAAAGCGCATTTAGCGAGATATGAAAGACTCTCTGATAAGCAGGAAAAGCGTA
TGATTCGTATTCATGGCTTAGCGATTGACACGCTGGCTAGAAGAGTATTTGTGAATGACAAAGAAGTGTTTTTTACAGCG
AAGGAATTCGATTTGCTGAAGTTTATCGTTTCTCATCCAAATCAAGTATTAAGTAAAGAACATCTATTTGAAAAAATTTG
GGGGTTTGATTCTTCAGGAGACATTTCAACCGTAACAGTTCACATTCGAAAACTAAGAGAAAAGTTAGAAGAAAACCCAG
CAGATCCTCAGTACCTAGAAACGGTTTGGGGAGCGGGATACCGGTTTAATATTTAA

Protein sequence :
MVIHMKKILLIEDEVSIAELQRDYLEINDFEIDVQYSGDKGLEKALNEHFDLVILDIMLPKVSGFEVCKQIRAAKDIPII
LVSAKKEEIDKIRGLGLGADDYITKPFSPGELVARVKAHLARYERLSDKQEKRMIRIHGLAIDTLARRVFVNDKEVFFTA
KEFDLLKFIVSHPNQVLSKEHLFEKIWGFDSSGDISTVTVHIRKLREKLEENPADPQYLETVWGAGYRFNI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-42 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-42 41
sboR YP_006309915.1 SboR Not tested FWisland_1 Protein 1e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BMWSH_2609 YP_005494800.1 Response regulators consisting of a CheY-like receiver domain protein NC_012469.1.7686381. Protein 8e-42 44
BMWSH_2609 YP_005494800.1 Response regulators consisting of a CheY-like receiver domain protein NC_014475.1.orf0.gen Protein 2e-45 43
BMWSH_2609 YP_005494800.1 Response regulators consisting of a CheY-like receiver domain protein NC_005054.2598277.p0 Protein 2e-45 43
BMWSH_2609 YP_005494800.1 Response regulators consisting of a CheY-like receiver domain protein FJ349556.1.orf0.gene Protein 6e-41 43
BMWSH_2609 YP_005494800.1 Response regulators consisting of a CheY-like receiver domain protein AF155139.2.orf0.gene Protein 8e-42 43
BMWSH_2609 YP_005494800.1 Response regulators consisting of a CheY-like receiver domain protein AM180355.1.gene1830. Protein 4e-42 43
BMWSH_2609 YP_005494800.1 Response regulators consisting of a CheY-like receiver domain protein NC_002952.2859905.p0 Protein 1e-43 42
BMWSH_2609 YP_005494800.1 Response regulators consisting of a CheY-like receiver domain protein NC_009641.5332272.p0 Protein 1e-43 42
BMWSH_2609 YP_005494800.1 Response regulators consisting of a CheY-like receiver domain protein NC_013450.8614421.p0 Protein 1e-43 42
BMWSH_2609 YP_005494800.1 Response regulators consisting of a CheY-like receiver domain protein NC_007793.3914279.p0 Protein 1e-43 42
BMWSH_2609 YP_005494800.1 Response regulators consisting of a CheY-like receiver domain protein NC_003923.1003749.p0 Protein 2e-43 42
BMWSH_2609 YP_005494800.1 Response regulators consisting of a CheY-like receiver domain protein NC_007622.3794472.p0 Protein 1e-43 42
BMWSH_2609 YP_005494800.1 Response regulators consisting of a CheY-like receiver domain protein NC_002745.1124361.p0 Protein 1e-43 42
BMWSH_2609 YP_005494800.1 Response regulators consisting of a CheY-like receiver domain protein NC_009782.5559369.p0 Protein 1e-43 42
BMWSH_2609 YP_005494800.1 Response regulators consisting of a CheY-like receiver domain protein AF130997.1.orf0.gene Protein 4e-38 42
BMWSH_2609 YP_005494800.1 Response regulators consisting of a CheY-like receiver domain protein NC_002951.3237708.p0 Protein 1e-43 42
BMWSH_2609 YP_005494800.1 Response regulators consisting of a CheY-like receiver domain protein NC_002758.1121668.p0 Protein 1e-43 42
BMWSH_2609 YP_005494800.1 Response regulators consisting of a CheY-like receiver domain protein AE016830.1.gene1681. Protein 3e-41 42
BMWSH_2609 YP_005494800.1 Response regulators consisting of a CheY-like receiver domain protein NC_012469.1.7685629. Protein 2e-41 42
BMWSH_2609 YP_005494800.1 Response regulators consisting of a CheY-like receiver domain protein DQ212986.1.gene4.p01 Protein 4e-39 42
BMWSH_2609 YP_005494800.1 Response regulators consisting of a CheY-like receiver domain protein EU250284.1.orf4.gene Protein 7e-41 42
BMWSH_2609 YP_005494800.1 Response regulators consisting of a CheY-like receiver domain protein NC_013450.8614146.p0 Protein 2e-40 41
BMWSH_2609 YP_005494800.1 Response regulators consisting of a CheY-like receiver domain protein NC_002951.3238224.p0 Protein 2e-40 41
BMWSH_2609 YP_005494800.1 Response regulators consisting of a CheY-like receiver domain protein NC_007793.3914065.p0 Protein 2e-40 41
BMWSH_2609 YP_005494800.1 Response regulators consisting of a CheY-like receiver domain protein NC_002758.1121390.p0 Protein 2e-40 41
BMWSH_2609 YP_005494800.1 Response regulators consisting of a CheY-like receiver domain protein NC_010079.5776364.p0 Protein 2e-40 41
BMWSH_2609 YP_005494800.1 Response regulators consisting of a CheY-like receiver domain protein NC_002952.2859858.p0 Protein 2e-40 41
BMWSH_2609 YP_005494800.1 Response regulators consisting of a CheY-like receiver domain protein NC_007622.3794948.p0 Protein 2e-40 41
BMWSH_2609 YP_005494800.1 Response regulators consisting of a CheY-like receiver domain protein NC_003923.1003417.p0 Protein 2e-40 41
BMWSH_2609 YP_005494800.1 Response regulators consisting of a CheY-like receiver domain protein HE999704.1.gene2815. Protein 2e-38 41
BMWSH_2609 YP_005494800.1 Response regulators consisting of a CheY-like receiver domain protein AF162694.1.orf4.gene Protein 3e-41 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BMWSH_2609 YP_005494800.1 Response regulators consisting of a CheY-like receiver domain protein VFG1702 Protein 2e-42 41
BMWSH_2609 YP_005494800.1 Response regulators consisting of a CheY-like receiver domain protein VFG1563 Protein 9e-43 41