Gene Information

Name : APA03_14320 (APA03_14320)
Accession : YP_005478026.1
Strain : Acetobacter pasteurianus IFO 3283
Genome accession: NC_017100
Putative virulence/resistance : Unknown
Product : transposase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1532811 - 1533158 bp
Length : 348 bp
Strand : +
Note : IS66 Orf2

DNA sequence :
ATGATCCCTCTTCCCTCTGGTCTGAAGATATGGCTGGCGGCAGGTGCAACAGACATGCGCCTTGGCATGCCCGGTCTGGC
GCTGAGGGTTCAACAGTTTCTGGGGAGAGACCCCTATGCTGGTGATGTTTTTGTCTTTCGTGGCCGACGCGGCGATCTGG
TGAAACTGATCTGGCATGACGGGATTGGAGTGTCCCTCTATGCAAAACGGATTGAACGTGGGTATTTCATCTGGCCCTCG
GCAAAGGACGGGGCCATCCATCTGAGTGCGTCACAATTAAGTTGTCTGCTCGAAGGGATCGACTGGCGTAATCCGCAGAA
AACATGGCGACCTGAACTGGCGGGGTAA

Protein sequence :
MIPLPSGLKIWLAAGATDMRLGMPGLALRVQQFLGRDPYAGDVFVFRGRRGDLVKLIWHDGIGVSLYAKRIERGYFIWPS
AKDGAIHLSASQLSCLLEGIDWRNPQKTWRPELAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 4e-20 61
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 8e-27 61
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 1e-26 61
unnamed AAL99258.1 unknown Not tested LEE Protein 8e-27 61
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 7e-27 61
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 8e-27 61
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 7e-27 61
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-26 61
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 1e-26 61
unnamed AAC31493.1 L0014 Not tested LEE Protein 8e-27 61
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 1e-26 61
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 6e-26 60
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 6e-26 60
unnamed AAL08461.1 unknown Not tested SRL Protein 2e-26 59
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 8e-24 57
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 2e-29 56
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 2e-29 56
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 5e-29 55
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 1e-27 54
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 1e-27 54
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 1e-26 49
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 1e-26 49
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-26 49
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 8e-26 49
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 8e-26 49

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
APA03_14320 YP_005478026.1 transposase VFG1517 Protein 2e-20 61
APA03_14320 YP_005478026.1 transposase VFG1698 Protein 2e-27 61
APA03_14320 YP_005478026.1 transposase VFG1709 Protein 3e-27 61
APA03_14320 YP_005478026.1 transposase VFG0792 Protein 3e-27 61
APA03_14320 YP_005478026.1 transposase VFG1052 Protein 7e-27 59
APA03_14320 YP_005478026.1 transposase VFG1665 Protein 2e-29 55
APA03_14320 YP_005478026.1 transposase VFG1737 Protein 4e-27 49