Gene Information

Name : S23_48810 (S23_48810)
Accession : YP_005452187.1
Strain : Bradyrhizobium sp. S23321
Genome accession: NC_017082
Putative virulence/resistance : Virulence
Product : putative two-component transcriptional regulatory protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4992241 - 4992915 bp
Length : 675 bp
Strand : -
Note : -

DNA sequence :
GTGCGCCTGCTCGTCGTTGAGGATGACCCCGATCTCAATCGCCAGCTCACCAAGGCGCTGAGCGACGCCGGTTACGTCGT
CGATCGCGCCTTCGACGGGGAGGAAGGGCATTTTCTCGGTGACAACGAGCCCTACGATGCCGTGGTGCTCGACATCGGCC
TGCCCAAGAGGGATGGCATCTCGGTGCTGGAAGCCTGGCGCCGCAATGGTCGTACCATGCCGGTCCTGATACTCACCGCG
CGCGACCGCTGGAGCGACAAGGTGCAGGGCTTTGATGCTGGCGCCGACGATTATGTCGCAAAGCCGTTCCATCTGGAGGA
GGTGCTGGCGCGCATCCGCGCCCTGCTGCGCCGCTCGACGGGCCATGCCCAGAGCGAACTCAGCTGCGGTCCCGTCACGC
TCGACACCAGGACCGGGCGGGTCAGCGTCTCCGGCAATCCCGTGAAGATGACCTCGCACGAATATCGGCTTCTGGCCTAC
CTAATGCATCATTCGGGGCGCGTCGTGTCCCGCACCGAGCTGGTTGAGCATCTCTACGACCAGGATTTCGACCGCGACTC
CAATACGATTGAGGTCTTCGTCGGCCGCATCCGCAAGAAGCTCGATGTCGATATCATCCAGACCGTCCGTGGTCTCGGCT
ATCTGCTGACCCCGCCGGCCGCGCCGGGCGCCTGA

Protein sequence :
MRLLVVEDDPDLNRQLTKALSDAGYVVDRAFDGEEGHFLGDNEPYDAVVLDIGLPKRDGISVLEAWRRNGRTMPVLILTA
RDRWSDKVQGFDAGADDYVAKPFHLEEVLARIRALLRRSTGHAQSELSCGPVTLDTRTGRVSVSGNPVKMTSHEYRLLAY
LMHHSGRVVSRTELVEHLYDQDFDRDSNTIEVFVGRIRKKLDVDIIQTVRGLGYLLTPPAAPGA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 3e-32 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
S23_48810 YP_005452187.1 putative two-component transcriptional regulatory protein NC_002516.2.879194.p Protein 2e-45 48
S23_48810 YP_005452187.1 putative two-component transcriptional regulatory protein CP000647.1.gene1136. Protein 2e-41 46
S23_48810 YP_005452187.1 putative two-component transcriptional regulatory protein BAC0530 Protein 2e-41 46
S23_48810 YP_005452187.1 putative two-component transcriptional regulatory protein CP004022.1.gene1005. Protein 3e-43 45
S23_48810 YP_005452187.1 putative two-component transcriptional regulatory protein BAC0487 Protein 2e-35 44
S23_48810 YP_005452187.1 putative two-component transcriptional regulatory protein NC_002695.1.913289.p Protein 6e-41 44
S23_48810 YP_005452187.1 putative two-component transcriptional regulatory protein CP000034.1.gene2022. Protein 2e-41 44
S23_48810 YP_005452187.1 putative two-component transcriptional regulatory protein CP001918.1.gene2526. Protein 3e-40 44
S23_48810 YP_005452187.1 putative two-component transcriptional regulatory protein CP001138.1.gene1939. Protein 2e-41 44
S23_48810 YP_005452187.1 putative two-component transcriptional regulatory protein BAC0125 Protein 4e-35 42
S23_48810 YP_005452187.1 putative two-component transcriptional regulatory protein BAC0347 Protein 1e-33 41
S23_48810 YP_005452187.1 putative two-component transcriptional regulatory protein BAC0638 Protein 1e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
S23_48810 YP_005452187.1 putative two-component transcriptional regulatory protein VFG0475 Protein 2e-41 44
S23_48810 YP_005452187.1 putative two-component transcriptional regulatory protein VFG1390 Protein 2e-33 43
S23_48810 YP_005452187.1 putative two-component transcriptional regulatory protein VFG0473 Protein 2e-33 41