Gene Information

Name : RGE_46610 (RGE_46610)
Accession : YP_005439493.1
Strain : Rubrivivax gelatinosus IL144
Genome accession: NC_017075
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4992324 - 4992995 bp
Length : 672 bp
Strand : +
Note : -

DNA sequence :

ATGCGCATCCTCATCGCCGAAGACGACCAGGTCCTGGCCGACGGTCTTCTGCGCTCGCTGCGGGCCTCGGGTTACGCGGT
CGACCAGGTCGGCAGCGGCACCGAGGCCGATGCCGCGCTGTCGGCGCACGAGTTCGACCTGCTGATCCTGGACCTGGGCC
TGCCCAAGCTGCACGGCTTCGAGGTGCTCAAGCGCCTGCGGGCGCGCGGCGCGGCGGTGCCGGTGCTGATCCTCACCGCC
GCCGACAGCGTCGAGCAGCGCGTCAAGGGCCTGGACCTGGGCGCCGACGACTACATGGCCAAGCCCTTCTCGCTGCAGGA
GCTGGAAGCCCGCGTGCGCGCGCTGACGCGCCGCGGCCTGGGCACCGCCTCCAGCGTCATCAAGCACGGCCCGCTGACCT
TCGACGCCACCGGCCGTGTCGCCTACCTCAACGACCAGATGATCGAGCTGTCGGCGCGCGAGCTGTCGCTGCTGGAGGTG
CTGCTGCAGCGCTCGGGCCGCCTGGTCAGCAAGGACCAGCTCGTCGAGCGCCTGTGCGAGTGGGGCGAGGAAGTCAGCAA
CAACGCGATCGAGGCGTACATCCACCGCCTGCGCAAGAAGATCGAGCAGGGTCCGGTGAGAATCGCCACGGTACGCGGCC
TGGGCTACTGCCTGGAAAAGATCGCGGCCTGA

Protein sequence :

MRILIAEDDQVLADGLLRSLRASGYAVDQVGSGTEADAALSAHEFDLLILDLGLPKLHGFEVLKRLRARGAAVPVLILTA
ADSVEQRVKGLDLGADDYMAKPFSLQELEARVRALTRRGLGTASSVIKHGPLTFDATGRVAYLNDQMIELSARELSLLEV
LLQRSGRLVSKDQLVERLCEWGEEVSNNAIEAYIHRLRKKIEQGPVRIATVRGLGYCLEKIAA

• Homologs from PAI DB

Gene	GenBank Accn	Product	Virulance or Resistance	PAI or REI	Alignment Type	E-val	Identity
armR	AAN62112.1	putative response-regulator ArmR	Not tested	PAGI-2(C)	Protein	1e-35	48

• Homologs from CARD and BacMet (resistance genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
RGE_46610	YP_005439493.1	winged helix family two component transcriptional regulator	BAC0487	Protein	2e-32	45
RGE_46610	YP_005439493.1	winged helix family two component transcriptional regulator	BAC0083	Protein	2e-31	45
RGE_46610	YP_005439493.1	winged helix family two component transcriptional regulator	BAC0638	Protein	3e-24	44
RGE_46610	YP_005439493.1	winged helix family two component transcriptional regulator	BAC0308	Protein	1e-28	42
RGE_46610	YP_005439493.1	winged helix family two component transcriptional regulator	BAC0197	Protein	5e-30	42
RGE_46610	YP_005439493.1	winged helix family two component transcriptional regulator	CP001485.1.gene721.p	Protein	5e-20	41
RGE_46610	YP_005439493.1	winged helix family two component transcriptional regulator	CP000647.1.gene1136.	Protein	1e-24	41
RGE_46610	YP_005439493.1	winged helix family two component transcriptional regulator	NC_002516.2.879194.p	Protein	7e-27	41
RGE_46610	YP_005439493.1	winged helix family two component transcriptional regulator	BAC0530	Protein	1e-24	41

• Homologs from VFDB (virulence genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
RGE_46610	YP_005439493.1	winged helix family two component transcriptional regulator	VFG0473	Protein	1e-34	43
RGE_46610	YP_005439493.1	winged helix family two component transcriptional regulator	VFG1390	Protein	3e-29	41
RGE_46610	YP_005439493.1	winged helix family two component transcriptional regulator	VFG1389	Protein	1e-24	41